Erigeron canadensis (horseweed): 122595223 Help Entry 122595223         CDS       T07610                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism ecad  Erigeron canadensis (horseweed) Pathway ecad04145   Phagosome ecad04148   Efferocytosis ecad04620   Toll-like receptor signaling pathway ecad05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:ecad00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     122595223    04148 Efferocytosis     122595223  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     122595223  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     122595223  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ecad04131]     122595223   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ecad04147]     122595223    04031 GTP-binding proteins [BR:ecad04031]     122595223 Membrane trafficking [BR:ecad04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     122595223  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     122595223   Macropinocytosis    Ras GTPases     122595223  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     122595223 Exosome [BR:ecad04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    122595223   Exosomal proteins of other body fluids (saliva and urine)    122595223   Exosomal proteins of colorectal cancer cells    122595223   Exosomal proteins of bladder cancer cells    122595223 GTP-binding proteins [BR:ecad04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     122595223 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU AAA_7 Motif Other DBs NCBI-GeneID:  122595223 NCBI-ProteinID:  XP_043623494 LinkDB All DBs Position 4:5867677..5871685 Genome browser AA seq 198 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELRHYAPGVPIILVGTKL DLRDDKQFFVDHPGAVPITTAQGEELKKLIGAPAYIECSSKTQQNVKAVFDAAIKVVLQP PKQKKKKKRKGQKACSIL NT seq 597 nt NT seq  +upstreamnt  +downstreamnt atgagtgcatcaagattcataaagtgtgtgacagttggtgatggggctgttggaaagact tgtatgcttatttcttacaccagcaacactttccccactgattacgtaccaactgttttc gacaattttagtgcaaatgtggtagtcgatggaagcaccgttaatcttgggttgtgggat accgcagggcaagaagattacaatagattgagacctttgagttatcgtggtgctgatgtc tttatactggcgttttctctcattagcaaggcaagctatgagaacgtctctaaaaagtgg attcctgaattgaggcattatgcacccggtgttccaataattcttgttggaacaaagcta gatcttcgtgatgacaagcagttctttgtagaccatcctggcgcagttccaatcacaaca gctcagggagaggagctgaagaagctaattggtgcccctgcttatattgagtgtagctca aaaacacagcagaatgtgaaggctgtttttgatgctgccattaaagtggttctgcagccc ccaaagcaaaagaagaaaaagaagcgaaagggtcaaaaggcatgctcgatattgtga

DBGET integrated database retrieval system