Erigeron canadensis (horseweed): 122600316 Help Entry 122600316         CDS       T07610                                  Name (RefSeq) polyubiquitin 9   KO K03873   elongin-B Organism ecad  Erigeron canadensis (horseweed) Pathway ecad04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:ecad00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     122600316  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:ecad04121]     122600316    03400 DNA repair and recombination proteins [BR:ecad03400]     122600316 Ubiquitin system [BR:ecad04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    Cul2 complex     Adoptor protein      122600316    Cul5 complex      122600316 DNA repair and recombination proteins [BR:ecad03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      122600316 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Dsc3_N Ubiquitin_5 Chal_sti_synt_N Motif Other DBs NCBI-GeneID:  122600316 NCBI-ProteinID:  XP_043628959 LinkDB All DBs Position 5:complement(4932976..4935303) Genome browser AA seq 104 aa AA seqDB search MAMYIRVKRNKTTYFLQCDATEKILDIKEKLHNLIDQPVNDQRLILVATGEVLDDSKTLA DQKVENDAVVALVLRKDDNEFEDVNIVRPDDFYQSRDADATGNW NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atggctatgtacattcgtgttaagcgtaataagacgacttactttttgcaatgtgatgca actgagaaaattttagatattaaggaaaagttgcataacctcatcgatcagcccgttaat gatcagcgtttaattttagtcgcgaccggagaagtcttggatgattcaaagacattggct gatcaaaaggttgaaaatgatgctgttgtggcacttgtgttgagaaaagatgacaacgaa tttgaggatgtgaacatagtgagaccagatgatttttatcagtctcgtgatgcagacgct actggtaattggtaa

DBGET integrated database retrieval system