Erigeron canadensis (horseweed): 122608946 Help Entry 122608946         CDS       T07610                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism ecad  Erigeron canadensis (horseweed) Pathway ecad03083   Polycomb repressive complex ecad04120   Ubiquitin mediated proteolysis ecad04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:ecad00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     122608946    04120 Ubiquitin mediated proteolysis     122608946   09126 Chromosome    03083 Polycomb repressive complex     122608946  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ecad04131]     122608946    04121 Ubiquitin system [BR:ecad04121]     122608946    03036 Chromosome and associated proteins [BR:ecad03036]     122608946 Membrane trafficking [BR:ecad04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     122608946 Ubiquitin system [BR:ecad04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      122608946    Cul7 complex      122608946 Chromosome and associated proteins [BR:ecad03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      122608946   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      122608946 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Skp1 DUF5888 CBM_35_2 Motif Other DBs NCBI-GeneID:  122608946 NCBI-ProteinID:  XP_043637949 LinkDB All DBs Position 7:10401026..10401504 Genome browser AA seq 145 aa AA seqDB search MSKAIVVKSSDGETFEIDEAVASQSQIIKYMIEDGCADGVIPLPNVTAKVLFKVIEYCKK HVDDNSETKKDNHHDAEAADLKTFDAEFMLSLKDVVKAAIYLEIQGLVDLCLDYTFNLDI VKNQFPDMTPEEEAKFRRENAWAFE NT seq 438 nt NT seq  +upstreamnt  +downstreamnt atgtcgaaggccatcgtggtcaagagttcagacggggagacgttcgagattgatgaggcg gtggctagtcagtcacagataatcaaatatatgattgaagacggatgtgctgatggtgtt atccctcttccaaacgtcaccgctaaggtccttttcaaagttatcgaatactgtaagaaa catgttgatgataattcagaaacaaagaaagataatcatcatgatgcagaggctgctgat cttaaaacgtttgatgccgagtttatgctgtcattgaaagatgttgtaaaggctgcaatt tatctggaaatccagggtctggtggatttatgcttggattatacattcaatctggacatt gtcaagaatcagttcccagacatgactcccgaagaggaagccaagtttcgtagggagaat gcatgggcttttgaatag

DBGET integrated database retrieval system