Erigeron canadensis (horseweed): 122610071
Help
Entry
122610071 CDS
T07610
Name
(RefSeq) SKP1-like protein 1B
KO
K03094
S-phase kinase-associated protein 1
Organism
ecad
Erigeron canadensis (horseweed)
Pathway
ecad03083
Polycomb repressive complex
ecad04120
Ubiquitin mediated proteolysis
ecad04141
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:
ecad00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
04141 Protein processing in endoplasmic reticulum
122610071
04120 Ubiquitin mediated proteolysis
122610071
09126 Chromosome
03083 Polycomb repressive complex
122610071
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:
ecad04131
]
122610071
04121 Ubiquitin system [BR:
ecad04121
]
122610071
03036 Chromosome and associated proteins [BR:
ecad03036
]
122610071
Membrane trafficking [BR:
ecad04131
]
Endosome - Lysosome transport
Acidification regulators
RAVE complex
122610071
Ubiquitin system [BR:
ecad04121
]
Ubiquitin ligases (E3)
Multi subunit type E3
SCF complex
Adaptor protein
122610071
Cul7 complex
122610071
Chromosome and associated proteins [BR:
ecad03036
]
Eukaryotic type
Histone modification proteins
Polycomb repressive complex (PRC) and associated proteins
Noncanonical PRC1 (PRC1.1)
122610071
Centromeric chromatin formation proteins
Kinetochore proteins
CBF3 complex
122610071
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Skp1
Skp1_POZ
BTB
Motif
Other DBs
NCBI-GeneID:
122610071
NCBI-ProteinID:
XP_043638988
LinkDB
All DBs
Position
8:complement(41145067..41146575)
Genome browser
AA seq
156 aa
AA seq
DB search
MAAENKSLVLKSSDGETFEVDEAVALQSQTIKHMVEDDCADNAIPLPNVTSQILSKVIEY
CKKHVENKADEDKPADDDLKSFDAEFVKVDQGTLFDLILAANYLNIKSLLDLTCQTVADM
IKGKTPEEIRKTFNIKNDFTPEEEEEVRRENAWAFE
NT seq
471 nt
NT seq
+upstream
nt +downstream
nt
atggccgcagaaaacaaatcgttagttttgaagagctctgatggcgagacctttgaggta
gatgaggccgtcgctctccagtcccaaaccataaaacatatggtggaggacgattgcgct
gataacgccatccctttgcctaatgtgaccagtcagatcttgtctaaagtgatcgagtat
tgtaaaaagcacgttgaaaacaaagctgacgaggacaagcctgctgatgacgatttgaaa
tcttttgatgctgaattcgttaaagtcgaccagggcactctctttgatctcatcttggct
gctaactatctgaacattaagagtttgctggacctgacctgccaaacagtggcggacatg
atcaaaggcaagacccctgaggagattcgcaagacgttcaacatcaaaaatgactttacc
cctgaagaagaggaggaggttcgtcgtgagaatgcctgggcttttgaatga
DBGET
integrated database retrieval system