Enterobacter cancerogenus: CWI88_14050 Help Entry CWI88_14050       CDS       T05545                                  Name (GenBank) DNA damage-inducible protein I   KO K12149   DNA-damage-inducible protein I Organism ecan  Enterobacter cancerogenus Brite KEGG Orthology (KO) [BR:ecan00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:ecan03400]     CWI88_14050 DNA repair and recombination proteins [BR:ecan03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     CWI88_14050 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI Motif Other DBs NCBI-ProteinID:  AUJ82104 UniProt:  A0A5Q2K5D9 LinkDB All DBs Position 2934526..2934771 Genome browser AA seq 81 aa AA seqDB search MRIEVTIAKTTVLPAGALDALAGELSRRIDENFPDNENPVTVRYATANNLSVIGGAKEDK ERISEILQETWESADDWFITD NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgcgtattgaagtcaccattgccaaaactaccgttctgcctgccggcgcgcttgatgca ctggcaggcgagctatcccgccgtattgacgaaaattttcctgataatgagaatcccgta acggtgcgttatgcgaccgcgaacaacctgtcggttatcggtggcgctaaagaagataaa gagcgtatcagtgaaattttgcaggaaacctgggaaagcgctgacgactggtttatcacc gattaa

DBGET integrated database retrieval system