Equus caballus (horse): 100033855 Help Entry 100033855         CDS       T01058                                  Symbol SOD1 Name (RefSeq) superoxide dismutase [Cu-Zn]   KO K04565   superoxide dismutase, Cu-Zn family [EC:1.15.1.1] Organism ecb  Equus caballus (horse) Pathway ecb04146   Peroxisome ecb04213   Longevity regulating pathway - multiple species ecb05012   Parkinson disease ecb05014   Amyotrophic lateral sclerosis ecb05016   Huntington disease ecb05020   Prion disease ecb05022   Pathways of neurodegeneration - multiple diseases ecb05208   Chemical carcinogenesis - reactive oxygen species Brite KEGG Orthology (KO) [BR:ecb00001]  09140 Cellular Processes   09141 Transport and catabolism    04146 Peroxisome     100033855 (SOD1)  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     100033855 (SOD1)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     100033855 (SOD1)   09164 Neurodegenerative disease    05012 Parkinson disease     100033855 (SOD1)    05014 Amyotrophic lateral sclerosis     100033855 (SOD1)    05016 Huntington disease     100033855 (SOD1)    05020 Prion disease     100033855 (SOD1)    05022 Pathways of neurodegeneration - multiple diseases     100033855 (SOD1) Enzymes [BR:ecb01000]  1. Oxidoreductases   1.15  Acting on superoxide as acceptor    1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)     1.15.1.1  superoxide dismutase      100033855 (SOD1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Sod_Cu Motif Other DBs NCBI-GeneID:  100033855 NCBI-ProteinID:  NP_001075295 Ensembl:  ENSECAG00000008958 VGNC:  23442 UniProt:  P00443 D7PPM2 LinkDB All DBs Position 26:29806051..29813255 Genome browser AA seq 154 aa AA seqDB search MALKAVCVLKGDGPVHGVIHFEQQQEGGPVVLKGFIEGLTKGDHGFHVHEFGDNTQGCTT AGAHFNPLSKKHGGPKDEERHVGDLGNVTADENGKADVDMKDSVISLSGKHSIIGRTMVV HEKQDDLGKGGNEESTKTGNAGSRLACGVIGIAP NT seq 465 nt NT seq  +upstreamnt  +downstreamnt atggcgctgaaggccgtgtgcgtgctgaagggcgatggcccggtgcacggcgtcatccac ttcgagcagcagcaggaaggtgggcccgtcgttctgaagggattcattgaaggattaacc aaaggcgatcacggattccacgtccacgagtttggagataatacacaaggctgtaccact gctggtgctcactttaatcctctgtcgaaaaaacacggtggaccaaaggacgaagagagg catgttggagacctgggcaatgtgactgctgatgaaaatggtaaggctgatgtggatatg aaagattctgtgatctcactctcgggaaagcattccatcattggccgcacaatggtggtc cacgagaaacaagatgacctgggcaaaggtggaaatgaagaaagtacaaagacggggaac gctggcagtcgtctggcttgtggtgtgattgggatcgctccgtaa

DBGET integrated database retrieval system