Equus caballus (horse): 100033949 Help Entry 100033949         CDS       T01058                                  Symbol CCL11 Name (RefSeq) eotaxin precursor   KO K16597   C-C motif chemokine 11 Organism ecb  Equus caballus (horse) Pathway ecb04060   Cytokine-cytokine receptor interaction ecb04061   Viral protein interaction with cytokine and cytokine receptor ecb04062   Chemokine signaling pathway ecb04657   IL-17 signaling pathway ecb05310   Asthma Brite KEGG Orthology (KO) [BR:ecb00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100033949 (CCL11)    04061 Viral protein interaction with cytokine and cytokine receptor     100033949 (CCL11)  09150 Organismal Systems   09151 Immune system    04657 IL-17 signaling pathway     100033949 (CCL11)    04062 Chemokine signaling pathway     100033949 (CCL11)  09160 Human Diseases   09163 Immune disease    05310 Asthma     100033949 (CCL11)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ecb04052]     100033949 (CCL11) Cytokines and neuropeptides [BR:ecb04052]  Cytokines   Chemokines    100033949 (CCL11) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  100033949 NCBI-ProteinID:  NP_001075340 UniProt:  Q9TTQ4 LinkDB All DBs Position 11:complement(38852350..38854438) Genome browser AA seq 100 aa AA seqDB search MKVSAALLCLLLTTAAFSTQVLAQPVSISTVCCFNVASRKISFQRLQSYRKITSSKCPQK AVIFKTKQAKKICADPKQKWVQDAMKYLDENSRTTKYSSF NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctccgcagccctcctgtgcctgctgctcaccacggccgccttcagcacccag gtgctggctcagccagtttctatctcgaccgtctgctgctttaacgtggccagtaggaag atctcttttcagcgactgcagagctacagaaaaatcaccagcagcaaatgtccccagaaa gctgtgatcttcaagaccaaacaagccaagaagatctgtgctgatcccaagcagaagtgg gtccaggatgccatgaagtacctggacgaaaactcccgaactacaaagtattcatctttt tga

DBGET integrated database retrieval system