Equus caballus (horse): 100034012 Help Entry 100034012         CDS       T01058                                  Symbol S100A10 Name (RefSeq) protein S100-A10   KO K17274   protein S100-A10 Organism ecb  Equus caballus (horse) Pathway ecb05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ecb00001]  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100034012 (S100A10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ecb04147]     100034012 (S100A10)    04990 Domain-containing proteins not elsewhere classified [BR:ecb04990]     100034012 (S100A10) Exosome [BR:ecb04147]  Exosomal proteins   Exosomal proteins of microglial cells    100034012 (S100A10) Domain-containing proteins not elsewhere classified [BR:ecb04990]  EF-hand domain-containing proteins   S100 proteins    100034012 (S100A10) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EFhand_Ca_insen EF-hand_8 EF-hand_6 TMP_3 Motif Other DBs NCBI-GeneID:  100034012 NCBI-ProteinID:  NP_001157339 Ensembl:  ENSECAG00000019382 VGNC:  22646 LinkDB All DBs Position 5:41971881..41981754 Genome browser AA seq 97 aa AA seqDB search MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLD QCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGRK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccatctcaaatggaacacgccatggaaacaatgatgttcacatttcacaaatttgct ggggataaaggctacttaacaaaggaagacctgagagtactcatggaaaaggagttcccc ggatttttggaaaatcaaaaagaccctctggccgtggacaagataatgaaggacctggac cagtgccgagacggcaaagtgggcttccagagcttcttttcgctaattgccgggctcacc atcgcatgcaatgactattttgtagtacacatgaagcagaagggaagaaagtag

DBGET integrated database retrieval system