Equus caballus (horse): 100034214 Help Entry 100034214         CDS       T01058                                  Symbol GAST Name (RefSeq) gastrin precursor   KO K13768   gastrin Organism ecb  Equus caballus (horse) Pathway ecb04081   Hormone signaling ecb04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:ecb00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04081 Hormone signaling     100034214 (GAST)  09150 Organismal Systems   09154 Digestive system    04971 Gastric acid secretion     100034214 (GAST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ecb04052]     100034214 (GAST) Cytokines and neuropeptides [BR:ecb04052]  Neuropeptides   GPCR binding    100034214 (GAST) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Gastrin Motif Other DBs NCBI-GeneID:  100034214 NCBI-ProteinID:  NP_001075979 Ensembl:  ENSECAG00000012504 VGNC:  49456 UniProt:  F6SYU3 LinkDB All DBs Position 11:complement(21151463..21154449) Genome browser AA seq 107 aa AA seqDB search MRRLCVYVLIFALALAAFSEASWKPCSQLQDAPSGPGANKGLDPHWPDQLDRLGPASHHR RQLGLQGSPHLVADLSKKQGPWLEKEEAAYGWMDFGRRSAEEGDQSP NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atgcggcgactgtgtgtgtatgtgctgatctttgcgctggctctggccgccttctccgaa gcttcttggaagccctgctcccagctgcaggacgcaccctcaggtccaggggccaataag ggcctggacccgcattggccagaccagctggacaggctgggcccagcctctcatcaccga aggcagctggggctccagggttccccacacttggtagcagacctgtccaagaagcaaggg ccatggctggaaaaagaagaagcagcctacggatggatggactttggccgccgcagcgct gaggaaggggatcaaagtccttag

DBGET integrated database retrieval system