Equus caballus (horse): 100050015 Help Entry 100050015         CDS       T01058                                  Symbol RAB7A Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism ecb  Equus caballus (horse) Pathway ecb04137   Mitophagy - animal ecb04140   Autophagy - animal ecb04144   Endocytosis ecb04145   Phagosome ecb04148   Efferocytosis ecb05132   Salmonella infection ecb05146   Amoebiasis ecb05152   Tuberculosis Brite KEGG Orthology (KO) [BR:ecb00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     100050015 (RAB7A)    04145 Phagosome     100050015 (RAB7A)    04140 Autophagy - animal     100050015 (RAB7A)    04137 Mitophagy - animal     100050015 (RAB7A)    04148 Efferocytosis     100050015 (RAB7A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100050015 (RAB7A)    05152 Tuberculosis     100050015 (RAB7A)   09174 Infectious disease: parasitic    05146 Amoebiasis     100050015 (RAB7A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ecb04131]     100050015 (RAB7A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ecb04147]     100050015 (RAB7A)    04031 GTP-binding proteins [BR:ecb04031]     100050015 (RAB7A) Membrane trafficking [BR:ecb04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     100050015 (RAB7A) Exosome [BR:ecb04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100050015 (RAB7A)   Exosomal proteins of other body fluids (saliva and urine)    100050015 (RAB7A)   Exosomal proteins of colorectal cancer cells    100050015 (RAB7A)   Exosomal proteins of bladder cancer cells    100050015 (RAB7A) GTP-binding proteins [BR:ecb04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     100050015 (RAB7A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA ATP_bind_1 cobW nSTAND3 PduV-EutP Septin AAA_7 NTPase_1 AAA_22 AAA_16 AAA_24 G-alpha AAA_5 ATPase_2 NACHT AAA_14 NB-ARC SRPRB ATP-synt_ab ABC_tran Motif Other DBs NCBI-GeneID:  100050015 NCBI-ProteinID:  XP_023475641 Ensembl:  ENSECAG00000012559 VGNC:  22126 LinkDB All DBs Position 16:2777694..2831057 Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKNDRAKAPGEGCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacctctaggaagaaagtgttactgaaggttatcatcttgggagattctggagtcggt aagacatcactcatgaaccagtatgtgaacaagaaattcagtaatcagtacaaagccaca ataggagcagactttcttacaaaggaggtgatggtggatgacagactagttacaatgcag atctgggacacggcaggacaggaacggttccagtctcttggtgtggccttctacagaggt gcagactgctgtgttctggtatttgatgtgactgcccccaacacgttcaaaactcttgat agctggagagatgagtttctcatccaggccagtccccgggatcctgaaaacttccccttt gttgtattgggaaacaagattgacctcgagaacagacaagtggccacaaagcgggcacag gcctggtgctacagcaaaaacaacattccctacttcgagaccagtgccaaggaggccatc aacgtggagcaggcgttccagacgattgcacggaatgcacttaaacaggaaacggaggtg gagctatacaatgaattccctgaacccatcaaactggacaagaatgaccgggccaaggcc ccgggagaaggctgcagctgctga

DBGET integrated database retrieval system