Equus caballus (horse): 100050760 Help Entry 100050760         CDS       T01058                                  Name (RefSeq) cystatin-B   KO K13907   cystatin-A/B Organism ecb  Equus caballus (horse) Brite KEGG Orthology (KO) [BR:ecb00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:ecb01002]     100050760   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ecb04147]     100050760 Peptidases and inhibitors [BR:ecb01002]  Peptidase inhibitors   Family I25: cystatin family    100050760 Exosome [BR:ecb04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    100050760 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cystatin Dynein_light Motif Other DBs NCBI-GeneID:  100050760 NCBI-ProteinID:  XP_001491190 Ensembl:  ENSECAG00000014222 LinkDB All DBs Position 26:complement(40338172..40341887) Genome browser AA seq 98 aa AA seqDB search MMCGAPSATQPATAETQAIADQVKSQLEEKENKKFPIFKAVEFRSQVVAGTNHFIKVQVG DDDFVHIRVFKSLPHENKPLALSSYQTNKARHDELSYF NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgatgtgcggcgcgccctccgccactcagcccgccactgccgagacccaggccatcgcc gaccaggtgaagtcacagctggaggagaaggaaaataagaagttccctatttttaaggct gtggagttccggagccaggtggtcgcggggacaaaccacttcatcaaggttcaggttggc gatgacgacttcgtgcacattcgagtgtttaaaagcctcccacacgaaaacaagcccctg gccttgtccagctatcagaccaacaaagccaggcacgacgagctgtcgtatttctag

DBGET integrated database retrieval system