Equus caballus (horse): 100050835 Help Entry 100050835         CDS       T01058                                  Name (RefSeq) cystatin-B   KO K13907   cystatin-A/B Organism ecb  Equus caballus (horse) Brite KEGG Orthology (KO) [BR:ecb00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:ecb01002]     100050835   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ecb04147]     100050835 Peptidases and inhibitors [BR:ecb01002]  Peptidase inhibitors   Family I25: cystatin family    100050835 Exosome [BR:ecb04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    100050835 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cystatin Dynein_light Motif Other DBs NCBI-GeneID:  100050835 NCBI-ProteinID:  XP_001491217 Ensembl:  ENSECAG00000014197 LinkDB All DBs Position 26:40326592..40330406 Genome browser AA seq 98 aa AA seqDB search MMCGAPSATQPATAETQAIADQVRSQLEEKENKKFPIFKAVEFRSQVVAGTNHFIKVQVG DDDFVHIRVFKSLPHENKPLALSSYQTNKARHDELSYF NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgatgtgcggcgcgccctccgccactcagcccgccacggccgagacccaggccatagcc gaccaggtgaggtcacagctggaggagaaggaaaataagaagttccctatttttaaggct gtggagttccggagccaggtggtcgcggggacaaaccacttcatcaaggttcaggttggc gatgacgacttcgtgcacattcgagtgtttaaaagcctcccacacgaaaacaagcccctg gccttgtccagctatcagaccaacaaagccaggcacgacgagctgtcgtatttctag

DBGET integrated database retrieval system