KEGG   Equus caballus (horse): 100051180
Entry
100051180         CDS       T01058                                 
Symbol
DDB2
Name
(RefSeq) DNA damage-binding protein 2 isoform X1
  KO
K10140  DNA damage-binding protein 2
Organism
ecb  Equus caballus (horse)
Pathway
ecb03420  Nucleotide excision repair
ecb04115  p53 signaling pathway
ecb04120  Ubiquitin mediated proteolysis
ecb05161  Hepatitis B
ecb05169  Epstein-Barr virus infection
ecb05200  Pathways in cancer
ecb05202  Transcriptional misregulation in cancer
ecb05210  Colorectal cancer
ecb05212  Pancreatic cancer
ecb05213  Endometrial cancer
ecb05214  Glioma
ecb05216  Thyroid cancer
ecb05217  Basal cell carcinoma
ecb05218  Melanoma
ecb05220  Chronic myeloid leukemia
ecb05222  Small cell lung cancer
ecb05223  Non-small cell lung cancer
ecb05224  Breast cancer
ecb05225  Hepatocellular carcinoma
ecb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100051180 (DDB2)
  09124 Replication and repair
   03420 Nucleotide excision repair
    100051180 (DDB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100051180 (DDB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100051180 (DDB2)
   05202 Transcriptional misregulation in cancer
    100051180 (DDB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100051180 (DDB2)
   05212 Pancreatic cancer
    100051180 (DDB2)
   05225 Hepatocellular carcinoma
    100051180 (DDB2)
   05226 Gastric cancer
    100051180 (DDB2)
   05214 Glioma
    100051180 (DDB2)
   05216 Thyroid cancer
    100051180 (DDB2)
   05220 Chronic myeloid leukemia
    100051180 (DDB2)
   05217 Basal cell carcinoma
    100051180 (DDB2)
   05218 Melanoma
    100051180 (DDB2)
   05213 Endometrial cancer
    100051180 (DDB2)
   05224 Breast cancer
    100051180 (DDB2)
   05222 Small cell lung cancer
    100051180 (DDB2)
   05223 Non-small cell lung cancer
    100051180 (DDB2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100051180 (DDB2)
   05169 Epstein-Barr virus infection
    100051180 (DDB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ecb04121]
    100051180 (DDB2)
   03400 DNA repair and recombination proteins [BR:ecb03400]
    100051180 (DDB2)
Ubiquitin system [BR:ecb04121]
 Ubiquitin ligases (E3)
  Multi subunit type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     100051180 (DDB2)
DNA repair and recombination proteins [BR:ecb03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      100051180 (DDB2)
SSDB
Motif
Pfam: WD40_CDC20-Fz WD40 WD40_Prp19 WD40_WDHD1_1st Beta-prop_EML_2 Beta-prop_WDR75_1st Beta-prop_RIG_2nd WDR55 Beta-prop_WDR90_POC16_2nd Beta-prop_IFT140_1st Beta-prop_EIPR1 EIF3I Beta-prop_TEP1_2nd ANAPC4_WD40 Beta-prop_WDR19_1st Beta-prop_CAF1B_HIR1 WD40_RFWD3 Beta-prop_TEP1_C NBCH_WD40 WD40_MABP1-WDR62_2nd Beta-prop_HPS5 Beta-prop_Vps41 WD_LRWD1 Beta-prop_WDR11_1st
Other DBs
NCBI-GeneID: 100051180
NCBI-ProteinID: XP_023509768
Ensembl: ENSECAG00000008711
VGNC: 17070
LinkDB
Position
12:11691531..11729191
AA seq 427 aa
MAPRKRPETQKTPEMVVRPKSKRSRSPRELEPEAKKLCAKGPGSSRRLDSGCLWAELASL
QVPPLCSSIVRALHQQKLGKASWSSLQQGLQQSFLRSLASYRIFQKAAPFDRRATSLAWH
PAHPSTLAVGSKGGDIMLWNFGVKDKPTFLKGIGAGGSITGLKFNPLNTDQFFTSSMEGT
TRLQDFKGNTLRVFSSYDTCNFWFCSLDVSAKSRMVVTGDNVGHVILLNMDGKELWNLRM
HKKKVTHVALNPCCDWFLATASVDQTVKIWDLRQVRGKSSFLYSLPHRHPVNAACFSPDG
AQLLTTDQKSEIRVYSASQWDCPLNLIPHPHRHFQHLTPIKATWHPRYNLIVVGRYPDPN
FKSCTPYELRTIDVFDGSSGKMMHQLYDPESSGIISLNEFNPIGDTLASVMGYHILIWSQ
EEAGMQK
NT seq 1284 nt   +upstreamnt  +downstreamnt
atggctcccaggaaacgtccagaaacccagaagacccccgagatggttgtgcgccccaag
agcaagaggagcaggagccccagggagctggagcccgaggccaagaagctctgtgcgaag
ggccccggttccagcagaagacttgactcaggctgcctttgggcggagttggctagcctg
caggtcccgccactgtgcagcagcatcgtcagggccctgcaccagcagaagctgggcaaa
gcttcctggtcatccctacagcagggtctccagcagtcctttttgcgctctctggcttct
taccggatattccaaaaggctgccccctttgacaggagggccacatccttggcgtggcac
ccagctcaccccagcaccctggctgtgggttccaaagggggagatatcatgctctggaac
tttggcgtaaaggacaaacccaccttccttaaagggattggagctggagggagcatcact
gggctgaagtttaaccctctcaataccgaccagtttttcacctcctcaatggagggaaca
actaggctgcaagactttaaaggcaacactctccgagttttttccagctatgacacctgc
aacttctggttttgcagcctggatgtgtctgccaaaagccgaatggtggtcacaggagac
aacgtgggccatgtgatcctgctgaacatggacggcaaggagctttggaatctgagaatg
cacaaaaagaaagtgacccatgtggccctgaacccgtgctgtgactggttcctggccaca
gcctccgtagatcaaacagtgaaaatctgggacctgcgccaggttagagggaaatccagc
ttcctctactcgctgccgcacaggcatcctgtcaacgcagcttgtttcagtcccgatgga
gcgcagctcctgaccactgaccagaagagcgagatccgggtttactctgcctcccagtgg
gactgccccctgaacctgatcccacaccctcaccgccacttccagcacctgacgcccatc
aaggcaacctggcatcctcggtacaacctcattgtcgtgggccgatacccagatcctaat
ttcaaaagttgtaccccctatgaattaaggacgatcgatgtgtttgatggaagctcaggg
aagatgatgcatcagctctatgacccagaatcttctggtatcatttcgctcaatgagttc
aatcccattggggacacgctggcctctgtgatgggttatcacattctcatttggagccag
gaggaagctgggatgcagaagtga

DBGET integrated database retrieval system