Equus caballus (horse): 100051997 Help Entry 100051997         CDS       T01058                                  Symbol RAB5A Name (RefSeq) ras-related protein Rab-5A   KO K07887   Ras-related protein Rab-5A Organism ecb  Equus caballus (horse) Pathway ecb04014   Ras signaling pathway ecb04137   Mitophagy - animal ecb04144   Endocytosis ecb04145   Phagocytosis ecb04148   Efferocytosis ecb04962   Vasopressin-regulated water reabsorption ecb05014   Amyotrophic lateral sclerosis ecb05022   Pathways of neurodegeneration - multiple diseases ecb05132   Salmonella infection ecb05146   Amoebiasis ecb05152   Tuberculosis Brite KEGG Orthology (KO) [BR:ecb00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     100051997 (RAB5A)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     100051997 (RAB5A)    04145 Phagocytosis     100051997 (RAB5A)    04137 Mitophagy - animal     100051997 (RAB5A)    04148 Efferocytosis     100051997 (RAB5A)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     100051997 (RAB5A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100051997 (RAB5A)    05152 Tuberculosis     100051997 (RAB5A)   09174 Infectious disease: parasitic    05146 Amoebiasis     100051997 (RAB5A)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     100051997 (RAB5A)    05022 Pathways of neurodegeneration - multiple diseases     100051997 (RAB5A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ecb04131]     100051997 (RAB5A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ecb04147]     100051997 (RAB5A)    04031 GTP-binding proteins [BR:ecb04031]     100051997 (RAB5A) Membrane trafficking [BR:ecb04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     100051997 (RAB5A)  Endosome - Lysosome transport     100051997 (RAB5A) Exosome [BR:ecb04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100051997 (RAB5A)   Exosomal proteins of other body fluids (saliva and urine)    100051997 (RAB5A)   Exosomal proteins of colorectal cancer cells    100051997 (RAB5A)   Exosomal proteins of bladder cancer cells    100051997 (RAB5A) GTP-binding proteins [BR:ecb04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     100051997 (RAB5A) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA MMR_HSR1 RsgA_GTPase AAA_16 BrnT_toxin Motif Other DBs NCBI-GeneID:  100051997 NCBI-ProteinID:  XP_001495368 Ensembl:  ENSECAG00000019062 VGNC:  22124 LinkDB All DBs Position 16:complement(63773765..63802991) Genome browser AA seq 215 aa AA seqDB search MANRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQ TVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQR QASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKK LPKNEPQNPGANSARGRGVDLTEPTQPTRSQCCSN NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atggctaatcgaggagcaacaagacccaacgggccaaatactggaaataaaatatgccag ttcaaactagtacttctgggagagtctgctgttggcaaatcaagcctagtgcttcgtttt gtgaagggccagtttcatgaatttcaagagagtaccatcggggctgcttttctaacccaa actgtgtgtcttgatgacacaacagtaaagtttgaaatatgggatacagctggtcaagaa cgataccatagcctagcaccaatgtactacagaggagcacaagctgccatagttgtttat gatatcacaaatgaggagtcctttgccagagccaaaaactgggttaaagaacttcagagg caagccagtcctaacattgtaatagctttatcaggaaacaaggctgaccttgcaaataaa agagctgtcgatttccaggaagcacagtcctatgcagatgacaacagtttattattcatg gagacatcagctaaaacatcaatgaatgtgaatgaaatattcatggcaatagctaaaaag ttgccaaagaatgaaccacagaatcccggagcaaattctgccagaggaagaggagtagac cttactgaacccacacagccaaccaggagtcagtgttgtagtaactaa

DBGET integrated database retrieval system