Equus caballus (horse): 100053249 Help Entry 100053249         CDS       T01058                                  Name (RefSeq) glutathione S-transferase P   KO K23790   glutathione S-transferase P [EC:2.5.1.18] Organism ecb  Equus caballus (horse) Pathway ecb00480   Glutathione metabolism ecb00980   Metabolism of xenobiotics by cytochrome P450 ecb00982   Drug metabolism - cytochrome P450 ecb00983   Drug metabolism - other enzymes ecb01100   Metabolic pathways ecb01524   Platinum drug resistance ecb05200   Pathways in cancer ecb05204   Chemical carcinogenesis - DNA adducts ecb05215   Prostate cancer ecb05225   Hepatocellular carcinoma ecb05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ecb00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     100053249   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     100053249    00982 Drug metabolism - cytochrome P450     100053249    00983 Drug metabolism - other enzymes     100053249  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100053249    05204 Chemical carcinogenesis - DNA adducts     100053249   09162 Cancer: specific types    05225 Hepatocellular carcinoma     100053249    05215 Prostate cancer     100053249   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     100053249   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     100053249  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:ecb02000]     100053249 Enzymes [BR:ecb01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      100053249 Transporters [BR:ecb02000]  Other transporters   Pores ion channels [TC:1]    100053249 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  GST_C_3 GST_C GST_N GST_C_7 GST_C_2 GST_N_2 GST_N_3 Motif Other DBs NCBI-GeneID:  100053249 NCBI-ProteinID:  XP_001498156 Ensembl:  ENSECAG00000020462 UniProt:  A0A9L0S861 LinkDB All DBs Position 12:31006342..31009240 Genome browser AA seq 210 aa AA seqDB search MPPYTIVYFSVRGRCEAMRMLLADQGQSWKEEVVTVDTWMQGPLKASCLYGQLPKFQDGD LTLYQSNAILRHLGRSLGLYGKDQREAALVDMVNDGVEDLRCKYVTLIYTNYEAGKEDYV KALPGHLKPFETLLSQNQGGQAFIVGNQISFADYNLLDLLLIHQVLAPSCLDSFPLLSAY VARLSARPKLKAFLASPEHVNLPINGNGKQ NT seq 633 nt NT seq  +upstreamnt  +downstreamnt atgccgccctacaccatcgtctacttctccgttcgagggcgctgtgaggccatgcgcatg ctgctggctgaccagggccagagctggaaggaggaggtggtgaccgtggacacctggatg cagggcccactcaaggcctcctgtctgtacgggcagctccccaagttccaggacggagac ctcaccctgtaccagtccaatgccatcctgagacacctgggccgctccctcgggctgtat gggaaggaccagcgggaggcggcgctggtggacatggtgaatgacggcgtggaggacctc cgctgcaaatacgtgactctcatctacaccaactatgaggccggcaaggaggactatgtg aaagcactgcccgggcacctgaagccttttgagaccctgctgtcccagaaccaggggggt caggctttcattgtgggcaaccagatctcctttgccgactacaacctgctggacttgctg ctgatccaccaggttctggcccccagctgcctggactctttccccctgctctcggcctac gtggcacgtctcagcgcccgccccaagctcaaggcattcctggcctcccccgagcacgtg aacctgcccatcaatggcaatgggaaacagtga

DBGET integrated database retrieval system