Equus caballus (horse): 100053343 Help Entry 100053343         CDS       T01058                                  Symbol RHOA Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism ecb  Equus caballus (horse) Pathway ecb04014   Ras signaling pathway ecb04015   Rap1 signaling pathway ecb04022   cGMP-PKG signaling pathway ecb04024   cAMP signaling pathway ecb04062   Chemokine signaling pathway ecb04071   Sphingolipid signaling pathway ecb04072   Phospholipase D signaling pathway ecb04081   Hormone signaling ecb04144   Endocytosis ecb04150   mTOR signaling pathway ecb04270   Vascular smooth muscle contraction ecb04310   Wnt signaling pathway ecb04350   TGF-beta signaling pathway ecb04360   Axon guidance ecb04510   Focal adhesion ecb04520   Adherens junction ecb04530   Tight junction ecb04611   Platelet activation ecb04621   NOD-like receptor signaling pathway ecb04625   C-type lectin receptor signaling pathway ecb04660   T cell receptor signaling pathway ecb04670   Leukocyte transendothelial migration ecb04722   Neurotrophin signaling pathway ecb04810   Regulation of actin cytoskeleton ecb04921   Oxytocin signaling pathway ecb04928   Parathyroid hormone synthesis, secretion and action ecb04972   Pancreatic secretion ecb05100   Bacterial invasion of epithelial cells ecb05132   Salmonella infection ecb05133   Pertussis ecb05135   Yersinia infection ecb05152   Tuberculosis ecb05163   Human cytomegalovirus infection ecb05200   Pathways in cancer ecb05203   Viral carcinogenesis ecb05205   Proteoglycans in cancer ecb05206   MicroRNAs in cancer ecb05210   Colorectal cancer ecb05417   Lipid and atherosclerosis ecb05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ecb00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     100053343 (RHOA)    04015 Rap1 signaling pathway     100053343 (RHOA)    04310 Wnt signaling pathway     100053343 (RHOA)    04350 TGF-beta signaling pathway     100053343 (RHOA)    04072 Phospholipase D signaling pathway     100053343 (RHOA)    04071 Sphingolipid signaling pathway     100053343 (RHOA)    04024 cAMP signaling pathway     100053343 (RHOA)    04022 cGMP-PKG signaling pathway     100053343 (RHOA)    04150 mTOR signaling pathway     100053343 (RHOA)   09133 Signaling molecules and interaction    04081 Hormone signaling     100053343 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     100053343 (RHOA)   09144 Cellular community - eukaryotes    04510 Focal adhesion     100053343 (RHOA)    04520 Adherens junction     100053343 (RHOA)    04530 Tight junction     100053343 (RHOA)   09142 Cell motility    04810 Regulation of actin cytoskeleton     100053343 (RHOA)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     100053343 (RHOA)    04621 NOD-like receptor signaling pathway     100053343 (RHOA)    04625 C-type lectin receptor signaling pathway     100053343 (RHOA)    04660 T cell receptor signaling pathway     100053343 (RHOA)    04670 Leukocyte transendothelial migration     100053343 (RHOA)    04062 Chemokine signaling pathway     100053343 (RHOA)   09152 Endocrine system    04921 Oxytocin signaling pathway     100053343 (RHOA)    04928 Parathyroid hormone synthesis, secretion and action     100053343 (RHOA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     100053343 (RHOA)   09154 Digestive system    04972 Pancreatic secretion     100053343 (RHOA)   09156 Nervous system    04722 Neurotrophin signaling pathway     100053343 (RHOA)   09158 Development and regeneration    04360 Axon guidance     100053343 (RHOA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100053343 (RHOA)    05206 MicroRNAs in cancer     100053343 (RHOA)    05205 Proteoglycans in cancer     100053343 (RHOA)    05203 Viral carcinogenesis     100053343 (RHOA)   09162 Cancer: specific types    05210 Colorectal cancer     100053343 (RHOA)   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     100053343 (RHOA)   09171 Infectious disease: bacterial    05132 Salmonella infection     100053343 (RHOA)    05135 Yersinia infection     100053343 (RHOA)    05133 Pertussis     100053343 (RHOA)    05152 Tuberculosis     100053343 (RHOA)    05100 Bacterial invasion of epithelial cells     100053343 (RHOA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100053343 (RHOA)    05418 Fluid shear stress and atherosclerosis     100053343 (RHOA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ecb04131]     100053343 (RHOA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ecb04147]     100053343 (RHOA)    04031 GTP-binding proteins [BR:ecb04031]     100053343 (RHOA) Membrane trafficking [BR:ecb04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     100053343 (RHOA) Exosome [BR:ecb04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100053343 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    100053343 (RHOA)   Exosomal proteins of colorectal cancer cells    100053343 (RHOA)   Exosomal proteins of bladder cancer cells    100053343 (RHOA) GTP-binding proteins [BR:ecb04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     100053343 (RHOA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  100053343 NCBI-ProteinID:  NP_001295875 UniProt:  K9K4D8 LinkDB All DBs Position 16:39272730..39328240 Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLVL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgccatcaggaagaaactcgtgattgttggtgatggagcctgtggcaagacttgc ttgctcatcgtctttagcaaggaccagttcccagaggtgtatgtacccacggtgtttgag aactatgtggcagatatcgaagtggatgggaagcaggtagagttagctttgtgggacaca gctgggcaggaagattatgatcgcttgaggcctctctcctacccagacaccgatgttata ctgatgtgtttctccattgacagccctgatagtttagaaaacatcccagaaaaatggact cctgaagtcaagcatttctgtcccaacgtgcccatcatcctggttggaaacaagaaggat cttcggaatgatgagcacacaaggcgggagctagccaagatgaagcaggagccggtaaaa ccagaagaaggcagagatatggcaaacaggattggtgcttttgggtacatggagtgttca gcaaagaccaaagatggagtgagggaggtttttgaaatggccacgagagctgctctccaa gccagacgtgggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system