Equus caballus (horse): 100056163 Help Entry 100056163         CDS       T01058                                  Symbol PFN4 Name (RefSeq) profilin-4 isoform X1   KO K05759   profilin Organism ecb  Equus caballus (horse) Pathway ecb04015   Rap1 signaling pathway ecb04810   Regulation of actin cytoskeleton ecb05014   Amyotrophic lateral sclerosis ecb05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ecb00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     100056163 (PFN4)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     100056163 (PFN4)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100056163 (PFN4)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     100056163 (PFN4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ecb04131]     100056163 (PFN4)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:ecb04812]     100056163 (PFN4)    04147 Exosome [BR:ecb04147]     100056163 (PFN4) Membrane trafficking [BR:ecb04131]  Others   Actin-binding proteins    Others     100056163 (PFN4) Cytoskeleton proteins [BR:ecb04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      100056163 (PFN4) Exosome [BR:ecb04147]  Exosomal proteins   Proteins found in most exosomes    100056163 (PFN4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  100056163 NCBI-ProteinID:  XP_001503221 Ensembl:  ENSECAG00000014609 VGNC:  21344 LinkDB All DBs Position 15:72619391..72625220 Genome browser AA seq 129 aa AA seqDB search MSHLHNLLLDTLLGTKHVDSAALIKIQERSLTVASPGFSVMPCDVRTLVNGFAKNPLQAR REGLYFREKDYKCVRADDHSLYAKNENTGVVVVKTHVYLLVATYIEGMYPSVCVEATEKL GEYLRKKGN NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgagccatttgcacaacttactgttagataccctcctgggaacgaagcatgtggacagt gcagccctcatcaaaatccaggagcggagcctgactgtagcatcaccaggatttagtgta atgccctgtgatgtccgaacacttgtgaatggattcgccaagaaccccttgcaagccaga agagaagggttgtatttcagggaaaaagactacaaatgtgtccgggcagatgaccattct ctttatgctaagaatgaaaacactggtgtggtggttgtgaagactcatgtgtatcttctg gtggcaacatacattgagggcatgtatcctagtgtttgtgtggaagccacagagaagctg ggagaatatctaagaaaaaaaggaaattaa

DBGET integrated database retrieval system