Equus caballus (horse): 100057603 Help Entry 100057603         CDS       T01058                                  Symbol CFL1 Name (RefSeq) cofilin-1   KO K05765   cofilin Organism ecb  Equus caballus (horse) Pathway ecb04360   Axon guidance ecb04666   Fc gamma R-mediated phagocytosis ecb04810   Regulation of actin cytoskeleton ecb05133   Pertussis ecb05170   Human immunodeficiency virus 1 infection Brite KEGG Orthology (KO) [BR:ecb00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     100057603 (CFL1)  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     100057603 (CFL1)   09158 Development and regeneration    04360 Axon guidance     100057603 (CFL1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100057603 (CFL1)   09171 Infectious disease: bacterial    05133 Pertussis     100057603 (CFL1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ecb04131]     100057603 (CFL1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:ecb04812]     100057603 (CFL1)    04147 Exosome [BR:ecb04147]     100057603 (CFL1) Membrane trafficking [BR:ecb04131]  Others   Actin-binding proteins    Others     100057603 (CFL1) Cytoskeleton proteins [BR:ecb04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     ADF / Cofilin      100057603 (CFL1) Exosome [BR:ecb04147]  Exosomal proteins   Proteins found in most exosomes    100057603 (CFL1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cofilin_ADF Motif Other DBs NCBI-GeneID:  100057603 NCBI-ProteinID:  XP_001494584 Ensembl:  ENSECAG00000019900 VGNC:  16464 LinkDB All DBs Position 12:complement(29653292..29657374) Genome browser AA seq 166 aa AA seqDB search MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDV GQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASS KDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atggcctctggtgtggctgtctctgatggcgtcatcaaagtgttcaatgacatgaaggtg cgtaagtcgtcaacaccagaggaggtaaagaagcgcaagaaggcagtgctcttctgcctg agtgaggacaagaagaacatcatcctcgaggagggcaaggagatcctggtaggtgatgtg ggccagaccgtagacgacccctacgccacctttgtcaagatgctgccagataaggactgc cgctacgccctctatgacgcaacctacgagaccaaggagagcaagaaggaggacctggtg tttatcttctgggcccctgagtctgcaccccttaagagcaaaatgatctacgccagctcc aaggacgccatcaagaagaagctgacggggatcaagcatgaattacaagcaaactgctac gaggaggtcaaggaccgttgcactctggcagagaagctggggggcagcgccgtcatctcc ctggagggcaagcctttgtga

DBGET integrated database retrieval system