KEGG   Equus caballus (horse): 100057701
Entry
100057701         CDS       T01058                                 
Symbol
MAPK1
Name
(RefSeq) mitogen-activated protein kinase 1 isoform X2
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
ecb  Equus caballus (horse)
Pathway
ecb01521  EGFR tyrosine kinase inhibitor resistance
ecb01522  Endocrine resistance
ecb01524  Platinum drug resistance
ecb04010  MAPK signaling pathway
ecb04012  ErbB signaling pathway
ecb04014  Ras signaling pathway
ecb04015  Rap1 signaling pathway
ecb04022  cGMP-PKG signaling pathway
ecb04024  cAMP signaling pathway
ecb04062  Chemokine signaling pathway
ecb04066  HIF-1 signaling pathway
ecb04068  FoxO signaling pathway
ecb04071  Sphingolipid signaling pathway
ecb04072  Phospholipase D signaling pathway
ecb04114  Oocyte meiosis
ecb04140  Autophagy - animal
ecb04148  Efferocytosis
ecb04150  mTOR signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04210  Apoptosis
ecb04218  Cellular senescence
ecb04261  Adrenergic signaling in cardiomyocytes
ecb04270  Vascular smooth muscle contraction
ecb04350  TGF-beta signaling pathway
ecb04360  Axon guidance
ecb04370  VEGF signaling pathway
ecb04371  Apelin signaling pathway
ecb04380  Osteoclast differentiation
ecb04510  Focal adhesion
ecb04517  IgSF CAM signaling
ecb04520  Adherens junction
ecb04540  Gap junction
ecb04550  Signaling pathways regulating pluripotency of stem cells
ecb04611  Platelet activation
ecb04613  Neutrophil extracellular trap formation
ecb04620  Toll-like receptor signaling pathway
ecb04621  NOD-like receptor signaling pathway
ecb04625  C-type lectin receptor signaling pathway
ecb04650  Natural killer cell mediated cytotoxicity
ecb04657  IL-17 signaling pathway
ecb04658  Th1 and Th2 cell differentiation
ecb04659  Th17 cell differentiation
ecb04660  T cell receptor signaling pathway
ecb04662  B cell receptor signaling pathway
ecb04664  Fc epsilon RI signaling pathway
ecb04666  Fc gamma R-mediated phagocytosis
ecb04668  TNF signaling pathway
ecb04713  Circadian entrainment
ecb04720  Long-term potentiation
ecb04722  Neurotrophin signaling pathway
ecb04723  Retrograde endocannabinoid signaling
ecb04724  Glutamatergic synapse
ecb04725  Cholinergic synapse
ecb04726  Serotonergic synapse
ecb04730  Long-term depression
ecb04810  Regulation of actin cytoskeleton
ecb04910  Insulin signaling pathway
ecb04912  GnRH signaling pathway
ecb04914  Progesterone-mediated oocyte maturation
ecb04915  Estrogen signaling pathway
ecb04916  Melanogenesis
ecb04917  Prolactin signaling pathway
ecb04919  Thyroid hormone signaling pathway
ecb04921  Oxytocin signaling pathway
ecb04926  Relaxin signaling pathway
ecb04928  Parathyroid hormone synthesis, secretion and action
ecb04929  GnRH secretion
ecb04930  Type II diabetes mellitus
ecb04933  AGE-RAGE signaling pathway in diabetic complications
ecb04934  Cushing syndrome
ecb04935  Growth hormone synthesis, secretion and action
ecb04960  Aldosterone-regulated sodium reabsorption
ecb05010  Alzheimer disease
ecb05020  Prion disease
ecb05022  Pathways of neurodegeneration - multiple diseases
ecb05034  Alcoholism
ecb05132  Salmonella infection
ecb05133  Pertussis
ecb05135  Yersinia infection
ecb05140  Leishmaniasis
ecb05142  Chagas disease
ecb05145  Toxoplasmosis
ecb05152  Tuberculosis
ecb05160  Hepatitis C
ecb05161  Hepatitis B
ecb05163  Human cytomegalovirus infection
ecb05164  Influenza A
ecb05165  Human papillomavirus infection
ecb05166  Human T-cell leukemia virus 1 infection
ecb05167  Kaposi sarcoma-associated herpesvirus infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05171  Coronavirus disease - COVID-19
ecb05200  Pathways in cancer
ecb05203  Viral carcinogenesis
ecb05205  Proteoglycans in cancer
ecb05206  MicroRNAs in cancer
ecb05207  Chemical carcinogenesis - receptor activation
ecb05208  Chemical carcinogenesis - reactive oxygen species
ecb05210  Colorectal cancer
ecb05211  Renal cell carcinoma
ecb05212  Pancreatic cancer
ecb05213  Endometrial cancer
ecb05214  Glioma
ecb05215  Prostate cancer
ecb05216  Thyroid cancer
ecb05218  Melanoma
ecb05219  Bladder cancer
ecb05220  Chronic myeloid leukemia
ecb05221  Acute myeloid leukemia
ecb05223  Non-small cell lung cancer
ecb05224  Breast cancer
ecb05225  Hepatocellular carcinoma
ecb05226  Gastric cancer
ecb05230  Central carbon metabolism in cancer
ecb05231  Choline metabolism in cancer
ecb05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ecb05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100057701 (MAPK1)
   04012 ErbB signaling pathway
    100057701 (MAPK1)
   04014 Ras signaling pathway
    100057701 (MAPK1)
   04015 Rap1 signaling pathway
    100057701 (MAPK1)
   04350 TGF-beta signaling pathway
    100057701 (MAPK1)
   04370 VEGF signaling pathway
    100057701 (MAPK1)
   04371 Apelin signaling pathway
    100057701 (MAPK1)
   04668 TNF signaling pathway
    100057701 (MAPK1)
   04066 HIF-1 signaling pathway
    100057701 (MAPK1)
   04068 FoxO signaling pathway
    100057701 (MAPK1)
   04072 Phospholipase D signaling pathway
    100057701 (MAPK1)
   04071 Sphingolipid signaling pathway
    100057701 (MAPK1)
   04024 cAMP signaling pathway
    100057701 (MAPK1)
   04022 cGMP-PKG signaling pathway
    100057701 (MAPK1)
   04151 PI3K-Akt signaling pathway
    100057701 (MAPK1)
   04150 mTOR signaling pathway
    100057701 (MAPK1)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    100057701 (MAPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100057701 (MAPK1)
   04148 Efferocytosis
    100057701 (MAPK1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100057701 (MAPK1)
   04210 Apoptosis
    100057701 (MAPK1)
   04218 Cellular senescence
    100057701 (MAPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100057701 (MAPK1)
   04520 Adherens junction
    100057701 (MAPK1)
   04540 Gap junction
    100057701 (MAPK1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100057701 (MAPK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100057701 (MAPK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100057701 (MAPK1)
   04613 Neutrophil extracellular trap formation
    100057701 (MAPK1)
   04620 Toll-like receptor signaling pathway
    100057701 (MAPK1)
   04621 NOD-like receptor signaling pathway
    100057701 (MAPK1)
   04625 C-type lectin receptor signaling pathway
    100057701 (MAPK1)
   04650 Natural killer cell mediated cytotoxicity
    100057701 (MAPK1)
   04660 T cell receptor signaling pathway
    100057701 (MAPK1)
   04658 Th1 and Th2 cell differentiation
    100057701 (MAPK1)
   04659 Th17 cell differentiation
    100057701 (MAPK1)
   04657 IL-17 signaling pathway
    100057701 (MAPK1)
   04662 B cell receptor signaling pathway
    100057701 (MAPK1)
   04664 Fc epsilon RI signaling pathway
    100057701 (MAPK1)
   04666 Fc gamma R-mediated phagocytosis
    100057701 (MAPK1)
   04062 Chemokine signaling pathway
    100057701 (MAPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100057701 (MAPK1)
   04929 GnRH secretion
    100057701 (MAPK1)
   04912 GnRH signaling pathway
    100057701 (MAPK1)
   04915 Estrogen signaling pathway
    100057701 (MAPK1)
   04914 Progesterone-mediated oocyte maturation
    100057701 (MAPK1)
   04917 Prolactin signaling pathway
    100057701 (MAPK1)
   04921 Oxytocin signaling pathway
    100057701 (MAPK1)
   04926 Relaxin signaling pathway
    100057701 (MAPK1)
   04935 Growth hormone synthesis, secretion and action
    100057701 (MAPK1)
   04919 Thyroid hormone signaling pathway
    100057701 (MAPK1)
   04928 Parathyroid hormone synthesis, secretion and action
    100057701 (MAPK1)
   04916 Melanogenesis
    100057701 (MAPK1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100057701 (MAPK1)
   04270 Vascular smooth muscle contraction
    100057701 (MAPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100057701 (MAPK1)
  09156 Nervous system
   04724 Glutamatergic synapse
    100057701 (MAPK1)
   04725 Cholinergic synapse
    100057701 (MAPK1)
   04726 Serotonergic synapse
    100057701 (MAPK1)
   04720 Long-term potentiation
    100057701 (MAPK1)
   04730 Long-term depression
    100057701 (MAPK1)
   04723 Retrograde endocannabinoid signaling
    100057701 (MAPK1)
   04722 Neurotrophin signaling pathway
    100057701 (MAPK1)
  09158 Development and regeneration
   04360 Axon guidance
    100057701 (MAPK1)
   04380 Osteoclast differentiation
    100057701 (MAPK1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100057701 (MAPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100057701 (MAPK1)
   05206 MicroRNAs in cancer
    100057701 (MAPK1)
   05205 Proteoglycans in cancer
    100057701 (MAPK1)
   05207 Chemical carcinogenesis - receptor activation
    100057701 (MAPK1)
   05208 Chemical carcinogenesis - reactive oxygen species
    100057701 (MAPK1)
   05203 Viral carcinogenesis
    100057701 (MAPK1)
   05230 Central carbon metabolism in cancer
    100057701 (MAPK1)
   05231 Choline metabolism in cancer
    100057701 (MAPK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100057701 (MAPK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100057701 (MAPK1)
   05212 Pancreatic cancer
    100057701 (MAPK1)
   05225 Hepatocellular carcinoma
    100057701 (MAPK1)
   05226 Gastric cancer
    100057701 (MAPK1)
   05214 Glioma
    100057701 (MAPK1)
   05216 Thyroid cancer
    100057701 (MAPK1)
   05221 Acute myeloid leukemia
    100057701 (MAPK1)
   05220 Chronic myeloid leukemia
    100057701 (MAPK1)
   05218 Melanoma
    100057701 (MAPK1)
   05211 Renal cell carcinoma
    100057701 (MAPK1)
   05219 Bladder cancer
    100057701 (MAPK1)
   05215 Prostate cancer
    100057701 (MAPK1)
   05213 Endometrial cancer
    100057701 (MAPK1)
   05224 Breast cancer
    100057701 (MAPK1)
   05223 Non-small cell lung cancer
    100057701 (MAPK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100057701 (MAPK1)
   05170 Human immunodeficiency virus 1 infection
    100057701 (MAPK1)
   05161 Hepatitis B
    100057701 (MAPK1)
   05160 Hepatitis C
    100057701 (MAPK1)
   05171 Coronavirus disease - COVID-19
    100057701 (MAPK1)
   05164 Influenza A
    100057701 (MAPK1)
   05163 Human cytomegalovirus infection
    100057701 (MAPK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100057701 (MAPK1)
   05165 Human papillomavirus infection
    100057701 (MAPK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100057701 (MAPK1)
   05135 Yersinia infection
    100057701 (MAPK1)
   05133 Pertussis
    100057701 (MAPK1)
   05152 Tuberculosis
    100057701 (MAPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100057701 (MAPK1)
   05140 Leishmaniasis
    100057701 (MAPK1)
   05142 Chagas disease
    100057701 (MAPK1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100057701 (MAPK1)
   05020 Prion disease
    100057701 (MAPK1)
   05022 Pathways of neurodegeneration - multiple diseases
    100057701 (MAPK1)
  09165 Substance dependence
   05034 Alcoholism
    100057701 (MAPK1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100057701 (MAPK1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100057701 (MAPK1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100057701 (MAPK1)
   04934 Cushing syndrome
    100057701 (MAPK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100057701 (MAPK1)
   01524 Platinum drug resistance
    100057701 (MAPK1)
   01522 Endocrine resistance
    100057701 (MAPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ecb01001]
    100057701 (MAPK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ecb03036]
    100057701 (MAPK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecb04147]
    100057701 (MAPK1)
Enzymes [BR:ecb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100057701 (MAPK1)
Protein kinases [BR:ecb01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100057701 (MAPK1)
Chromosome and associated proteins [BR:ecb03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     100057701 (MAPK1)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100057701 (MAPK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH RIO1 STATB_N Haspin_kinase FTA2 Kinase-like Kdo
Other DBs
NCBI-GeneID: 100057701
NCBI-ProteinID: XP_005612439
Ensembl: ENSECAG00000010551
VGNC: 19954
UniProt: A0A5F5PIW7
LinkDB
Position
8:complement(5463317..5568728)
AA seq 327 aa
MYPEKSSSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAP
TIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPS
NLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWS
VGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKV
PWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDM
ELDDLPKEKLKELIFEETARFQPGYRS
NT seq 984 nt   +upstreamnt  +downstreamnt
atgtatccagagaaaagcagctctgcttatgataatgtcaacaaagttcgagtagctatc
aagaaaatcagtccttttgagcaccagacctactgccagagaaccctgagggagataaaa
atcttactgcgcttcagacatgagaacatcattggaatcaatgatattattcgagcgcca
accatcgagcaaatgaaagatgtatatatagtacaggacctcatggaaacggatctctac
aaactcttgaagacccaacacctcagcaacgaccatatctgctattttctttaccagatc
ctcagagggttaaaatatatccattcagctaacgtactgcatcgtgacctcaaaccttcc
aacctgctgctcaataccacctgtgatctcaagatctgtgactttggcttggcccgtgtt
gcagatccggaccatgatcacacagggttcctgacggagtatgtagccacgcgttggtac
agggctccagaaattatgttgaattccaagggctataccaagtccattgatatttggtct
gtaggctgcattctggcagagatgctctccaacaggcctatcttcccggggaagcattat
cttgaccagctgaaccacattctgggtattcttggatccccatcacaggaagacctgaat
tgtataataaatttaaaagctagaaactatttgctttctcttccacacaaaaataaggtg
ccatggaacaggctgttcccaaatgctgactccaaagctctcgacttgctggacaaaatg
ttgacattcaaccctcacaagaggatcgaagtagagcaggctctggcccacccgtacctg
gagcagtactatgacccgagtgacgagcccatcgctgaagcaccattcaagtttgacatg
gaattggatgatttgcccaaggaaaagctcaaagaactcatttttgaagagactgctaga
ttccagccaggatacagatcttaa

DBGET integrated database retrieval system