Equus caballus (horse): 100058000 Help Entry 100058000         CDS       T01058                                  Symbol NFKBIA Name (RefSeq) NF-kappa-B inhibitor alpha   KO K04734   NF-kappa-B inhibitor alpha Organism ecb  Equus caballus (horse) Pathway ecb04024   cAMP signaling pathway ecb04062   Chemokine signaling pathway ecb04064   NF-kappa B signaling pathway ecb04210   Apoptosis ecb04380   Osteoclast differentiation ecb04620   Toll-like receptor signaling pathway ecb04621   NOD-like receptor signaling pathway ecb04622   RIG-I-like receptor signaling pathway ecb04623   Cytosolic DNA-sensing pathway ecb04625   C-type lectin receptor signaling pathway ecb04657   IL-17 signaling pathway ecb04658   Th1 and Th2 cell differentiation ecb04659   Th17 cell differentiation ecb04660   T cell receptor signaling pathway ecb04662   B cell receptor signaling pathway ecb04668   TNF signaling pathway ecb04722   Neurotrophin signaling pathway ecb04920   Adipocytokine signaling pathway ecb04926   Relaxin signaling pathway ecb04931   Insulin resistance ecb04936   Alcoholic liver disease ecb05132   Salmonella infection ecb05134   Legionellosis ecb05135   Yersinia infection ecb05140   Leishmaniasis ecb05142   Chagas disease ecb05145   Toxoplasmosis ecb05160   Hepatitis C ecb05161   Hepatitis B ecb05162   Measles ecb05163   Human cytomegalovirus infection ecb05164   Influenza A ecb05166   Human T-cell leukemia virus 1 infection ecb05167   Kaposi sarcoma-associated herpesvirus infection ecb05168   Herpes simplex virus 1 infection ecb05169   Epstein-Barr virus infection ecb05170   Human immunodeficiency virus 1 infection ecb05171   Coronavirus disease - COVID-19 ecb05200   Pathways in cancer ecb05203   Viral carcinogenesis ecb05208   Chemical carcinogenesis - reactive oxygen species ecb05215   Prostate cancer ecb05220   Chronic myeloid leukemia ecb05222   Small cell lung cancer ecb05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ecb05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ecb00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     100058000 (NFKBIA)    04668 TNF signaling pathway     100058000 (NFKBIA)    04024 cAMP signaling pathway     100058000 (NFKBIA)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     100058000 (NFKBIA)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100058000 (NFKBIA)    04621 NOD-like receptor signaling pathway     100058000 (NFKBIA)    04622 RIG-I-like receptor signaling pathway     100058000 (NFKBIA)    04623 Cytosolic DNA-sensing pathway     100058000 (NFKBIA)    04625 C-type lectin receptor signaling pathway     100058000 (NFKBIA)    04660 T cell receptor signaling pathway     100058000 (NFKBIA)    04658 Th1 and Th2 cell differentiation     100058000 (NFKBIA)    04659 Th17 cell differentiation     100058000 (NFKBIA)    04657 IL-17 signaling pathway     100058000 (NFKBIA)    04662 B cell receptor signaling pathway     100058000 (NFKBIA)    04062 Chemokine signaling pathway     100058000 (NFKBIA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     100058000 (NFKBIA)    04926 Relaxin signaling pathway     100058000 (NFKBIA)   09156 Nervous system    04722 Neurotrophin signaling pathway     100058000 (NFKBIA)   09158 Development and regeneration    04380 Osteoclast differentiation     100058000 (NFKBIA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100058000 (NFKBIA)    05208 Chemical carcinogenesis - reactive oxygen species     100058000 (NFKBIA)    05203 Viral carcinogenesis     100058000 (NFKBIA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     100058000 (NFKBIA)   09162 Cancer: specific types    05220 Chronic myeloid leukemia     100058000 (NFKBIA)    05215 Prostate cancer     100058000 (NFKBIA)    05222 Small cell lung cancer     100058000 (NFKBIA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100058000 (NFKBIA)    05170 Human immunodeficiency virus 1 infection     100058000 (NFKBIA)    05161 Hepatitis B     100058000 (NFKBIA)    05160 Hepatitis C     100058000 (NFKBIA)    05171 Coronavirus disease - COVID-19     100058000 (NFKBIA)    05164 Influenza A     100058000 (NFKBIA)    05162 Measles     100058000 (NFKBIA)    05168 Herpes simplex virus 1 infection     100058000 (NFKBIA)    05163 Human cytomegalovirus infection     100058000 (NFKBIA)    05167 Kaposi sarcoma-associated herpesvirus infection     100058000 (NFKBIA)    05169 Epstein-Barr virus infection     100058000 (NFKBIA)   09171 Infectious disease: bacterial    05132 Salmonella infection     100058000 (NFKBIA)    05135 Yersinia infection     100058000 (NFKBIA)    05134 Legionellosis     100058000 (NFKBIA)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     100058000 (NFKBIA)    05140 Leishmaniasis     100058000 (NFKBIA)    05142 Chagas disease     100058000 (NFKBIA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100058000 (NFKBIA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     100058000 (NFKBIA)    04931 Insulin resistance     100058000 (NFKBIA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:ecb03000]     100058000 (NFKBIA)    04131 Membrane trafficking [BR:ecb04131]     100058000 (NFKBIA) Transcription factors [BR:ecb03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Ankyrin only     100058000 (NFKBIA) Membrane trafficking [BR:ecb04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     100058000 (NFKBIA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ank_2 Ank Ank_3 Ank_5 Ank_4 ANK_LRRK2 Motif Other DBs NCBI-GeneID:  100058000 NCBI-ProteinID:  XP_023479790 VGNC:  51608 UniProt:  F6UAP0 LinkDB All DBs Position 1:complement(174102704..174105923) Genome browser AA seq 314 aa AA seqDB search MFQPAEPGQEWAMEGPRDALKKERLLDDRHDSGLDSMKDEEYEQMVKELREIRLEPQEAP RGAEPWKQQLTEDGDSFLHLAIIHEEKALTMEVVRQVKGDLAFLNFQNNLQQTPLHLAVI TNQPEIAKALLEAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQSYGTPHLHSILQATN YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEDEL PYDDCVLGGQRLTL NT seq 945 nt NT seq  +upstreamnt  +downstreamnt atgtttcagcccgccgagcccggccaggagtgggccatggagggcccgcgggacgcgctc aagaaggagcggctgctggacgaccgccacgacagcggcctggactccatgaaggacgag gagtacgagcagatggtgaaggagctgcgcgagatccgcctggagccgcaggaggcgccg cggggcgccgaaccctggaagcagcagctcaccgaggacggagactcgttcctgcacttg gccatcatccacgaagagaaggccctgaccatggaggtggtccgccaagtgaagggagac ctggcgttcctcaacttccagaacaacctgcagcagactccactccacttggctgtgatc accaaccagccagaaattgctaaggcacttctggaagctggctgtgatcctgagctccga gactttcgaggaaatacccccctacaccttgcctgtgagcagggctgcctggccagcgtg ggagtcctgactcagtcctacggaaccccgcacctccattccatcctgcaggccactaac tacaacggccacacgtgtctgcacctagcctctatccacggctacctgggcatcgtggag cttctggtgtccttgggtgctgatgtcaatgctcaggagccctgtaatggccgaactgcc ctccatctcgctgtggacctgcagaatcctgacctggtgtcgctcttgttgaaatgtggg gctgacgtcaacagagtcacctaccagggctactccccgtaccagcttacctggggccgc ccgagcacccggatacagcagcagctgggccagctgaccctagaaaaccttcagatgctg ccagagagcgaggatgaggagagctatgacacggagtcagagttcacggaggacgagctg ccctatgatgactgtgtgcttggaggacagcgcctgacgctatga

DBGET integrated database retrieval system