Equus caballus (horse): 100058184 Help Entry 100058184         CDS       T01058                                  Symbol BRK1 Name (RefSeq) protein BRICK1   KO K05752   chromosome 3 open reading frame 10 Organism ecb  Equus caballus (horse) Pathway ecb04810   Regulation of actin cytoskeleton ecb05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ecb00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     100058184 (BRK1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100058184 (BRK1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CCDC53 SPX Matrilin_ccoil LXG DUF5617 Motif Other DBs NCBI-GeneID:  100058184 NCBI-ProteinID:  XP_001493938 LinkDB All DBs Position 16:complement(8295107..8304066) Genome browser AA seq 75 aa AA seqDB search MAGQEDPVQREIHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERR IEYIEARVTKGETLT NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggcgggacaagaggatccggtgcagcgggagattcaccaggactgggcgaaccgggag tacattgaggtcatcaccagcagcatcaagaaaatcgcggactttctcaactctttcgat atgtcttgtcgttcaagactcgcaacactaaacgagaaattgacagcccttgaacggaga atagagtacattgaagcccgggtgacaaaaggtgagacgctcacctag

DBGET integrated database retrieval system