Equus caballus (horse): 100058321 Help Entry 100058321         CDS       T01058                                  Symbol LTA Name (RefSeq) lymphotoxin-alpha   KO K05468   lymphotoxin alpha (TNF superfamily, member 1) Organism ecb  Equus caballus (horse) Pathway ecb04060   Cytokine-cytokine receptor interaction ecb04061   Viral protein interaction with cytokine and cytokine receptor ecb04064   NF-kappa B signaling pathway ecb04668   TNF signaling pathway ecb04940   Type I diabetes mellitus ecb05166   Human T-cell leukemia virus 1 infection ecb05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:ecb00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     100058321 (LTA)    04668 TNF signaling pathway     100058321 (LTA)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100058321 (LTA)    04061 Viral protein interaction with cytokine and cytokine receptor     100058321 (LTA)  09160 Human Diseases   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100058321 (LTA)    05168 Herpes simplex virus 1 infection     100058321 (LTA)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     100058321 (LTA)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ecb04052]     100058321 (LTA) Cytokines and neuropeptides [BR:ecb04052]  Cytokines   Tumor necrosis fators    100058321 (LTA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TNF Motif Other DBs NCBI-GeneID:  100058321 NCBI-ProteinID:  XP_001491383 Ensembl:  ENSECAG00000000967 VGNC:  19829 UniProt:  A0A0U5J6U8 LinkDB All DBs Position 20:32217362..32222063 Genome browser AA seq 204 aa AA seqDB search MTPSGRLYLLRVCGAPLLLLLGLLLALPPEAQGLPGVGLSPSAARTAHQHPQKHFTQDTL KPAAHLVGDPSTQNSLRWRANTDRAFLRHGFSLSNNSLLVPTSGLYFVYSQVVFSGEGCF PKATPTPLYLAHEVQLFSSQYPFHVPLLSAQKSVCPGPQGPWVRSVYQGAVFLLTQGDQL STHTDGIPHLLLSPSSVFFGAFAL NT seq 615 nt NT seq  +upstreamnt  +downstreamnt atgacaccatctggacgtctctacctcctgagggtgtgcggcgcccccctcctcctcctt ctggggttgctgctggccctgccgcctgaggcccaggggctccctggtgttggcctgtca ccctcagctgcccggactgcccatcagcacccccagaagcacttcacccaagacactctc aaacctgctgctcaccttgttggagaccccagcacccagaactccttgcgctggagagca aacacagatcgtgccttcctccgccatggcttctctttgagcaacaattccctcctggtc cccaccagtggcctctacttcgtctactcccaggtggtcttctctggggaaggctgcttc cctaaggccaccccaacccctctctacctggctcacgaggtccagctcttctcttcccag taccccttccacgtgcctctcctcagcgctcagaagtccgtgtgcccagggccacaggga ccttgggtgcgctcagtgtaccagggggctgtgttcctgctcacccagggagaccagcta tccactcacacagatggcatccctcacctactccttagtcccagtagtgtcttctttggg gcctttgctctgtag

DBGET integrated database retrieval system