Equus caballus (horse): 100060980 Help Entry 100060980         CDS       T01058                                  Name (RefSeq) histone H2B type 3-A   KO K11252   histone H2B Organism ecb  Equus caballus (horse) Pathway ecb04613   Neutrophil extracellular trap formation ecb05034   Alcoholism ecb05203   Viral carcinogenesis ecb05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:ecb00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     100060980  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     100060980   09163 Immune disease    05322 Systemic lupus erythematosus     100060980   09165 Substance dependence    05034 Alcoholism     100060980  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ecb03036]     100060980   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ecb04147]     100060980 Chromosome and associated proteins [BR:ecb03036]  Eukaryotic type   Nucleosome assembly factors    Histones     100060980 Exosome [BR:ecb04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100060980 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa ARM_TT21 LonB_AAA-LID CENP-T_C Motif Other DBs NCBI-GeneID:  100060980 NCBI-ProteinID:  XP_005599709 Ensembl:  ENSECAG00000004412 LinkDB All DBs Position 14:93970099..93972357 Genome browser AA seq 126 aa AA seqDB search MPELSRSAPAPKKGSKKAISKAQKKDGKKRKRGRKESYSIYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIASEASRLAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgccagagctctcccgttcggcgccggcgcccaaaaagggctccaaaaaggctattagc aaggcgcagaagaaggacggcaaaaagcgtaagcgcggccgcaaggagagctactccatc tacgtgtacaaggtgctgaagcaggtccaccccgacaccggcatctcgtccaaggccatg ggcatcatgaactcgttcgtcaacgacatcttcgagcgcatcgccagcgaggcctcccgc ctggcgcactacaacaagcgctcgaccatcacgtcccgcgaggtgcagacggccgtgcgc ctgctgctgcccggcgagctggccaagcacgccgtgtccgagggcaccaaggccgtcacc aagtacaccagctccaagtga

DBGET integrated database retrieval system