Equus caballus (horse): 100061208 Help Entry 100061208         CDS       T01058                                  Symbol CCL24 Name (RefSeq) C-C motif chemokine 24   KO K21097   C-C motif chemokine 24 Organism ecb  Equus caballus (horse) Pathway ecb04060   Cytokine-cytokine receptor interaction ecb04061   Viral protein interaction with cytokine and cytokine receptor ecb04062   Chemokine signaling pathway Brite KEGG Orthology (KO) [BR:ecb00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100061208 (CCL24)    04061 Viral protein interaction with cytokine and cytokine receptor     100061208 (CCL24)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     100061208 (CCL24)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ecb04052]     100061208 (CCL24) Cytokines and neuropeptides [BR:ecb04052]  Cytokines   Chemokines    100061208 (CCL24) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  100061208 NCBI-ProteinID:  XP_014585405 Ensembl:  ENSECAG00000022259 VGNC:  16200 UniProt:  A0A3Q2KVU7 LinkDB All DBs Position 13:11041847..11044720 Genome browser AA seq 109 aa AA seqDB search MAGPATVIAGLLLLALCAHHIAPAGSAHIPSFCCMSFISKKIPESRVVSYQLSNGSVCPM AGVLFTTRKGQKFCGDPRQRWVKRYVKNLAAKNKKASTGTRAMSTTVAV NT seq 330 nt NT seq  +upstreamnt  +downstreamnt atggcaggccctgcgactgtcatagctggcctcctgctcctggccctgtgtgcccaccac attgcccctgcagggtctgcgcacatcccctctttctgctgcatgtccttcatctccaag aaaattcctgagagccgagtggtaagctaccagctgtccaacgggagcgtctgccccatg gcaggagtgctcttcaccaccaggaagggccagaagttctgtggcgaccccaggcagcgg tgggtcaagaggtacgtgaagaatctggctgccaagaataagaaggcctccactgggacc agggccatgagcaccacagtcgctgtctag

DBGET integrated database retrieval system