Equus caballus (horse): 100061295 Help Entry 100061295         CDS       T01058                                  Symbol PFN1 Name (RefSeq) profilin-1   KO K05759   profilin Organism ecb  Equus caballus (horse) Pathway ecb04015   Rap1 signaling pathway ecb04810   Regulation of actin cytoskeleton ecb05014   Amyotrophic lateral sclerosis ecb05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ecb00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     100061295 (PFN1)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     100061295 (PFN1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100061295 (PFN1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     100061295 (PFN1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ecb04131]     100061295 (PFN1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:ecb04812]     100061295 (PFN1)    04147 Exosome [BR:ecb04147]     100061295 (PFN1) Membrane trafficking [BR:ecb04131]  Others   Actin-binding proteins    Others     100061295 (PFN1) Cytoskeleton proteins [BR:ecb04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      100061295 (PFN1) Exosome [BR:ecb04147]  Exosomal proteins   Proteins found in most exosomes    100061295 (PFN1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  100061295 NCBI-ProteinID:  XP_014583788 Ensembl:  ENSECAG00000021116 LinkDB All DBs Position 11:49916443..49919356 Genome browser AA seq 140 aa AA seqDB search MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFF VNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNITVTMTAKTLVLLMGKEGVH GGMINKKCYEMASHLRRSQY NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccgggtggaacgcctacatcgacaacctcatggcggacgggacctgtcaggacgcg gccatcgtgggctataaggactcgccctccgtctgggccgccgtccccgggaaaaccttc gtcaacatcacgccagctgaggttggtgtcctggttggcaaagaccggtcaagttttttc gtgaatgggctgacacttgggggccagaaatgttctgtgatccgggactcactgctgcag gatggagaatttaccatggatcttcgtaccaagagcaccggcggagcccccaccttcaac atcactgtcaccatgactgccaagacgctagtcctgctgatgggcaaagaaggtgtccac ggtggtatgatcaacaagaaatgttatgaaatggcctcccacctgcggcgttcccagtac tga

DBGET integrated database retrieval system