KEGG   Equus caballus (horse): 100062824
Entry
100062824         CDS       T01058                                 
Symbol
FXYD6
Name
(RefSeq) FXYD domain-containing ion transport regulator 6 isoform X1
  KO
K13363  FXYD domain-containing ion transport regulator 6
Organism
ecb  Equus caballus (horse)
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecb02000]
    100062824 (FXYD6)
Transporters [BR:ecb02000]
 Other transporters
  Pores ion channels [TC:1]
   100062824 (FXYD6)
SSDB
Motif
Pfam: ATP1G1_PLM_MAT8 Glycophorin_A
Other DBs
NCBI-GeneID: 100062824
NCBI-ProteinID: XP_001502751
Ensembl: ENSECAG00000000698
LinkDB
Position
7:complement(26322673..26356371)
AA seq 95 aa
MEVVLIFLCSLLAPAVLASAAEQEKEKDPFHYDYQTLRIGGLVFAVVLFSLGILLILSRR
CKCSFNHKPRAPGDEEAQVGNLITANATEPQKAEN
NT seq 288 nt   +upstreamnt  +downstreamnt
atggaggtggtgctgatctttctctgcagcctgctggcccctgcggtcctggccagtgca
gccgagcaggagaaagaaaaggaccctttccattatgactaccagaccctgaggatcggg
ggactggtgttcgccgtggtcctcttctccctggggatcctcctcatcctaagtcgcagg
tgcaagtgcagtttcaatcataagccccgggctccaggggacgaggaggcccaggtggga
aacctcatcactgcaaacgcaacggagccccagaaagcggagaactga

DBGET integrated database retrieval system