Equus caballus (horse): 100064440 Help Entry 100064440         CDS       T01058                                  Symbol RHEB Name (RefSeq) GTP-binding protein Rheb   KO K07208   Ras homolog enriched in brain Organism ecb  Equus caballus (horse) Pathway ecb04072   Phospholipase D signaling pathway ecb04140   Autophagy - animal ecb04150   mTOR signaling pathway ecb04151   PI3K-Akt signaling pathway ecb04152   AMPK signaling pathway ecb04211   Longevity regulating pathway ecb04218   Cellular senescence ecb04714   Thermogenesis ecb04910   Insulin signaling pathway ecb04919   Thyroid hormone signaling pathway ecb05163   Human cytomegalovirus infection ecb05165   Human papillomavirus infection ecb05168   Herpes simplex virus 1 infection ecb05231   Choline metabolism in cancer Brite KEGG Orthology (KO) [BR:ecb00001]  09130 Environmental Information Processing   09132 Signal transduction    04072 Phospholipase D signaling pathway     100064440 (RHEB)    04151 PI3K-Akt signaling pathway     100064440 (RHEB)    04152 AMPK signaling pathway     100064440 (RHEB)    04150 mTOR signaling pathway     100064440 (RHEB)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100064440 (RHEB)   09143 Cell growth and death    04218 Cellular senescence     100064440 (RHEB)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     100064440 (RHEB)    04919 Thyroid hormone signaling pathway     100064440 (RHEB)   09149 Aging    04211 Longevity regulating pathway     100064440 (RHEB)   09159 Environmental adaptation    04714 Thermogenesis     100064440 (RHEB)  09160 Human Diseases   09161 Cancer: overview    05231 Choline metabolism in cancer     100064440 (RHEB)   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     100064440 (RHEB)    05163 Human cytomegalovirus infection     100064440 (RHEB)    05165 Human papillomavirus infection     100064440 (RHEB)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:ecb04031]     100064440 (RHEB) GTP-binding proteins [BR:ecb04031]  Small (monomeric) G-proteins   Ras Family    Rheb     100064440 (RHEB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase SRPRB AAA_14 RhoGAP_pG1_pG2 DUF1842 Motif Other DBs NCBI-GeneID:  100064440 NCBI-ProteinID:  XP_023495792 Ensembl:  ENSECAG00000010046 VGNC:  22367 LinkDB All DBs Position 4:complement(103131966..103176773) Genome browser AA seq 184 aa AA seqDB search MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVD TAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNK KDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEKIDGAASQGKSS CSVM NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgccgcagtccaagtcccggaagatcgcgatcctgggctaccggtctgtggggaaatcc tcgttgacgattcagtttgttgaaggccaatttgttgactcctacgatccaaccatagaa aacactttcacaaaattgatcacagtgaatggacaagaatatcatcttcaacttgtagac acagctgggcaagatgaatattccatctttcctcagacatactccatagatattaatggt tatattcttgtgtattctgttacatcaatcaaaagttttgaagtgattaaagttatccat ggcaaattgttggatatggtggggaaagtgcaaatacctattatgttggttgggaataag aaagacctacatatggaaagggtgatcagttatgaagaagggaaagcattagcggaatct tggaatgcagcttttttggaatcttctgctaaagaaaatcagactgctgttgatgttttt agaaggataattttggaggcagagaaaattgatggggctgcttcccaagggaagtcttcc tgctcagtgatgtag

DBGET integrated database retrieval system