Equus caballus (horse): 100065920 Help Entry 100065920         CDS       T01058                                  Symbol ARF6 Name (RefSeq) ADP-ribosylation factor 6   KO K07941   ADP-ribosylation factor 6 Organism ecb  Equus caballus (horse) Pathway ecb04014   Ras signaling pathway ecb04072   Phospholipase D signaling pathway ecb04144   Endocytosis ecb04517   IgSF CAM signaling ecb04666   Fc gamma R-mediated phagocytosis ecb05132   Salmonella infection ecb05135   Yersinia infection Brite KEGG Orthology (KO) [BR:ecb00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     100065920 (ARF6)    04072 Phospholipase D signaling pathway     100065920 (ARF6)   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     100065920 (ARF6)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     100065920 (ARF6)  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     100065920 (ARF6)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100065920 (ARF6)    05135 Yersinia infection     100065920 (ARF6)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ecb04131]     100065920 (ARF6)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ecb04147]     100065920 (ARF6)    04031 GTP-binding proteins [BR:ecb04031]     100065920 (ARF6) Membrane trafficking [BR:ecb04131]  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     100065920 (ARF6)   Arf GTPases and associated proteins    Arf GTPases     100065920 (ARF6) Exosome [BR:ecb04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100065920 (ARF6)   Exosomal proteins of colorectal cancer cells    100065920 (ARF6) GTP-binding proteins [BR:ecb04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     100065920 (ARF6) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Arf Roc G-alpha Ras SRPRB Gtr1_RagA MMR_HSR1 GTP_EFTU 6PF2K SpoOE-like CRISPR_Cas2 Motif Other DBs NCBI-GeneID:  100065920 NCBI-ProteinID:  XP_005603520 Ensembl:  ENSECAG00000005219 VGNC:  15446 LinkDB All DBs Position 1:186233359..186236895 Genome browser AA seq 175 aa AA seqDB search MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFN VWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIF ANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS NT seq 528 nt NT seq  +upstreamnt  +downstreamnt atggggaaggtgctgtccaagatcttcgggaacaaggagatgcggatcctcatgctgggc ctggacgcggccggcaagaccaccatcctgtacaagctgaagctcggccagtcggtgacc accatccccacggtgggcttcaacgtggagacggtgacttacaaaaacgtcaagttcaac gtgtgggacgtgggcggccaggacaagatccggccgctctggcggcactactacaccggg acccagggcctgatcttcgtggtggactgcgccgaccgcgaccgcatcgacgaggcccgc caggagctgcaccgcatcatcaacgaccgggagatgcgggacgccatcatcctcatcttc gccaacaagcaggacctgcccgatgccatgaagccccacgagatccaggagaaactgggc ctgacccggattcgggacaggaactggtatgtgcagccctcgtgtgccacctcgggggac ggactctatgaggggctcacatggttaacctctaactacaaatcctaa

DBGET integrated database retrieval system