KEGG   Equus caballus (horse): 100070422
Entry
100070422         CDS       T01058                                 
Name
(RefSeq) calmodulin-like protein 3
  KO
K02183  calmodulin
Organism
ecb  Equus caballus (horse)
Pathway
ecb04014  Ras signaling pathway
ecb04015  Rap1 signaling pathway
ecb04020  Calcium signaling pathway
ecb04022  cGMP-PKG signaling pathway
ecb04024  cAMP signaling pathway
ecb04070  Phosphatidylinositol signaling system
ecb04114  Oocyte meiosis
ecb04218  Cellular senescence
ecb04261  Adrenergic signaling in cardiomyocytes
ecb04270  Vascular smooth muscle contraction
ecb04371  Apelin signaling pathway
ecb04625  C-type lectin receptor signaling pathway
ecb04713  Circadian entrainment
ecb04720  Long-term potentiation
ecb04722  Neurotrophin signaling pathway
ecb04728  Dopaminergic synapse
ecb04740  Olfactory transduction
ecb04744  Phototransduction
ecb04750  Inflammatory mediator regulation of TRP channels
ecb04910  Insulin signaling pathway
ecb04912  GnRH signaling pathway
ecb04915  Estrogen signaling pathway
ecb04916  Melanogenesis
ecb04921  Oxytocin signaling pathway
ecb04922  Glucagon signaling pathway
ecb04924  Renin secretion
ecb04925  Aldosterone synthesis and secretion
ecb04970  Salivary secretion
ecb04971  Gastric acid secretion
ecb05010  Alzheimer disease
ecb05012  Parkinson disease
ecb05022  Pathways of neurodegeneration - multiple diseases
ecb05031  Amphetamine addiction
ecb05034  Alcoholism
ecb05133  Pertussis
ecb05152  Tuberculosis
ecb05163  Human cytomegalovirus infection
ecb05167  Kaposi sarcoma-associated herpesvirus infection
ecb05170  Human immunodeficiency virus 1 infection
ecb05200  Pathways in cancer
ecb05214  Glioma
ecb05417  Lipid and atherosclerosis
ecb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100070422
   04015 Rap1 signaling pathway
    100070422
   04371 Apelin signaling pathway
    100070422
   04020 Calcium signaling pathway
    100070422
   04070 Phosphatidylinositol signaling system
    100070422
   04024 cAMP signaling pathway
    100070422
   04022 cGMP-PKG signaling pathway
    100070422
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100070422
   04218 Cellular senescence
    100070422
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100070422
  09152 Endocrine system
   04910 Insulin signaling pathway
    100070422
   04922 Glucagon signaling pathway
    100070422
   04912 GnRH signaling pathway
    100070422
   04915 Estrogen signaling pathway
    100070422
   04921 Oxytocin signaling pathway
    100070422
   04916 Melanogenesis
    100070422
   04924 Renin secretion
    100070422
   04925 Aldosterone synthesis and secretion
    100070422
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100070422
   04270 Vascular smooth muscle contraction
    100070422
  09154 Digestive system
   04970 Salivary secretion
    100070422
   04971 Gastric acid secretion
    100070422
  09156 Nervous system
   04728 Dopaminergic synapse
    100070422
   04720 Long-term potentiation
    100070422
   04722 Neurotrophin signaling pathway
    100070422
  09157 Sensory system
   04744 Phototransduction
    100070422
   04740 Olfactory transduction
    100070422
   04750 Inflammatory mediator regulation of TRP channels
    100070422
  09159 Environmental adaptation
   04713 Circadian entrainment
    100070422
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100070422
  09162 Cancer: specific types
   05214 Glioma
    100070422
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100070422
   05163 Human cytomegalovirus infection
    100070422
   05167 Kaposi sarcoma-associated herpesvirus infection
    100070422
  09171 Infectious disease: bacterial
   05133 Pertussis
    100070422
   05152 Tuberculosis
    100070422
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100070422
   05012 Parkinson disease
    100070422
   05022 Pathways of neurodegeneration - multiple diseases
    100070422
  09165 Substance dependence
   05031 Amphetamine addiction
    100070422
   05034 Alcoholism
    100070422
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100070422
   05418 Fluid shear stress and atherosclerosis
    100070422
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ecb01009]
    100070422
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ecb04131]
    100070422
   03036 Chromosome and associated proteins [BR:ecb03036]
    100070422
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecb04147]
    100070422
Protein phosphatases and associated proteins [BR:ecb01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     100070422
Membrane trafficking [BR:ecb04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    100070422
Chromosome and associated proteins [BR:ecb03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Centriole replication proteins
     100070422
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100070422
SSDB
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 AIF-1 EF-hand_9 SPARC_Ca_bdg EF_EFCAB10_C DUF5580_M EFhand_Ca_insen Caleosin Dockerin_1 EF-hand_11 EH FCaBP_EF-hand Latarcin
Other DBs
NCBI-GeneID: 100070422
NCBI-ProteinID: XP_014592591
Ensembl: ENSECAG00000006393
LinkDB
Position
29:complement(29521685..29523298)
AA seq 149 aa
MADELTEEQVAVFREAFALFDKDGDGIITTQELGTVMRSLGQSPTEAELQGMVSKVDHDG
NRTVDFPEFLDMMAKKMKDRDSEEEIREAFRMFDKDGNGFISTAELRHMTTRLGEKLTKE
EVDKMIRAADVDGDGQVNYEEFVRMLVPK
NT seq 450 nt   +upstreamnt  +downstreamnt
atggctgatgagctgacagaggagcaggtggccgtcttcagggaggccttcgccctgttc
gacaaggatggggatggcatcatcaccacccaggagctgggcactgtcatgcggtcccta
ggccagagccccacagaggccgagctacagggcatggtgagcaaggtcgaccatgatggc
aacaggaccgtggacttccctgagttcctggacatgatggccaagaagatgaaggacagg
gacagtgaggaagagatccgggaggccttccgcatgttcgacaaggatggcaacggcttc
atcagcacggctgagctacggcacatgacaaccaggctgggagagaagctgaccaaagag
gaggtggacaagatgatccgggcagccgatgtggatggggatgggcaggtgaactatgag
gagttcgtccgcatgctggtccccaagtga

DBGET integrated database retrieval system