Equus caballus (horse): 100146754 Help Entry 100146754         CDS       T01058                                  Symbol PFN3 Name (RefSeq) profilin-3   KO K05759   profilin Organism ecb  Equus caballus (horse) Pathway ecb04015   Rap1 signaling pathway ecb04810   Regulation of actin cytoskeleton ecb05014   Amyotrophic lateral sclerosis ecb05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ecb00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     100146754 (PFN3)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     100146754 (PFN3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100146754 (PFN3)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     100146754 (PFN3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ecb04131]     100146754 (PFN3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:ecb04812]     100146754 (PFN3)    04147 Exosome [BR:ecb04147]     100146754 (PFN3) Membrane trafficking [BR:ecb04131]  Others   Actin-binding proteins    Others     100146754 (PFN3) Cytoskeleton proteins [BR:ecb04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      100146754 (PFN3) Exosome [BR:ecb04147]  Exosomal proteins   Proteins found in most exosomes    100146754 (PFN3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin TAT_signal Motif Other DBs NCBI-GeneID:  100146754 NCBI-ProteinID:  XP_001916689 Ensembl:  ENSECAG00000005555 VGNC:  21343 LinkDB All DBs Position 14:3986841..3987372 Genome browser AA seq 137 aa AA seqDB search MGDWKSYISAVLRDQRVDDVAIVGHSDNSCVWASRPGGLLAAISPQEVGVLIGPDRRTFL KAGLSVAGRRCCVIRDHLLAEGDGVLDARTKGLDGRAVCVGHTPRALLVLMGRRGVHGGM LNKMVHGLIRGLRAQGT NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgggcgactggaaaagctacataagtgcggtgctgcgggaccagcgcgttgacgacgtg gccatcgtgggccattcggacaatagctgcgtgtgggcatcgcggcccgggggcctgctg gcggccatctccccgcaggaggtgggtgtgctgatagggccggaccggcgcaccttcctg aaggccggcctgagcgtggcgggccgccgctgctgcgtcattcgcgatcacctgctggcc gagggcgacggagtactggacgcacgcaccaagggcctagacgggcgcgccgtctgcgtg ggccacactccgcgcgcgctcctcgtgctcatgggtcggcggggcgtgcacggaggcatg ctcaacaagatggtgcacgggctgatccgcgggctgcgtgcgcagggcacctag

DBGET integrated database retrieval system