Equus caballus (horse): 100629524 Help Entry 100629524         CDS       T01058                                  Symbol CSTA Name (RefSeq) cystatin-A   KO K13907   cystatin-A/B Organism ecb  Equus caballus (horse) Brite KEGG Orthology (KO) [BR:ecb00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:ecb01002]     100629524 (CSTA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ecb04147]     100629524 (CSTA) Peptidases and inhibitors [BR:ecb01002]  Peptidase inhibitors   Family I25: cystatin family    100629524 (CSTA) Exosome [BR:ecb04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    100629524 (CSTA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cystatin SQAPI Afaf Dynein_light DAHP_snth_FXD RHIM HET-S Motif Other DBs NCBI-GeneID:  100629524 NCBI-ProteinID:  XP_003363423 Ensembl:  ENSECAG00000024043 VGNC:  16918 LinkDB All DBs Position 19:complement(39676465..39687060) Genome browser AA seq 102 aa AA seqDB search MMSGGMPGGLTEARPATPEIQEIADRVKPQLEEKTNQTYEEFKAVEYKTQVVAGTNYYIK VQVGDNNYIHLKIFKSLPQQNESLTLTGYQTDKRKDDELKGF NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atgatgtctggagggatgcctggagggttaactgaagccagacctgccactccagaaatc caggagattgctgatagggttaaaccacaacttgaagaaaaaacaaatcagacttatgaa gaatttaaagctgtggagtataaaactcaagtggttgctggaacaaattactacattaag gtgcaagtaggtgataataattatattcatctgaaaatattcaaaagtcttcctcaacaa aatgagtctttgacacttactggttaccagactgacaaaaggaaagacgatgagctgaag ggcttttag

DBGET integrated database retrieval system