Equus caballus (horse): 100630364 Help Entry 100630364         CDS       T01058                                  Symbol PFN2 Name (RefSeq) profilin-2 isoform X1   KO K05759   profilin Organism ecb  Equus caballus (horse) Pathway ecb04015   Rap1 signaling pathway ecb04810   Regulation of actin cytoskeleton ecb05014   Amyotrophic lateral sclerosis ecb05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ecb00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     100630364 (PFN2)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     100630364 (PFN2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100630364 (PFN2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     100630364 (PFN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ecb04131]     100630364 (PFN2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:ecb04812]     100630364 (PFN2)    04147 Exosome [BR:ecb04147]     100630364 (PFN2) Membrane trafficking [BR:ecb04131]  Others   Actin-binding proteins    Others     100630364 (PFN2) Cytoskeleton proteins [BR:ecb04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      100630364 (PFN2) Exosome [BR:ecb04147]  Exosomal proteins   Proteins found in most exosomes    100630364 (PFN2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  100630364 NCBI-ProteinID:  XP_023476867 LinkDB All DBs Position 16:complement(84229964..84235528) Genome browser AA seq 140 aa AA seqDB search MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPVEIDMIVGKDREGFF TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVH GGGLNKKAYSMAKYLRDSGF NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccgggtggcagagctacgtggacaacctgatgtgcgatggctgctgccaggaggcc gccattgtcggctactgcgacgccaaatacgtgtgggccgccacggccgggggcgtcttt cagagcatcacgccagtagaaatagatatgattgtaggaaaagaccgggaaggtttcttt accaacggtttgactcttggcgcaaagaagtgctcagtgatcagagatagcctatacgtc gatggtgactgcacgatggacatccggacgaagagtcaaggtggggagccaacatacaac gttgccgtcggcagagctggtagagtcttggtctttgtaatgggaaaagaaggggtccat ggaggcggattgaataagaaggcatactcaatggcaaaatacttgagagactctgggttc tag

DBGET integrated database retrieval system