Equus caballus (horse): 100630543 Help Entry 100630543         CDS       T01058                                  Name (RefSeq) metallothionein-1B   KO K14739   metallothionein 1/2 Organism ecb  Equus caballus (horse) Pathway ecb04978   Mineral absorption Brite KEGG Orthology (KO) [BR:ecb00001]  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     100630543  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:ecb03019]     100630543    03029 Mitochondrial biogenesis [BR:ecb03029]     100630543 Messenger RNA biogenesis [BR:ecb03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      100630543 Mitochondrial biogenesis [BR:ecb03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     100630543 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  100630543 NCBI-ProteinID:  XP_003364645 Ensembl:  ENSECAG00000015275 LinkDB All DBs Position 3:9700576..9701525 Genome browser AA seq 61 aa AA seqDB search MDPDCSCVAGESCTCAGSCKCKQCRCASCKKSCCSCCPVGCAKCAQGCVCKGASDKCSCC A NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atggaccccgactgctcctgcgtcgccggtgaatcctgcacctgcgccggctcctgcaaa tgcaaacagtgcagatgcgcctcctgcaagaagagctgctgctcctgctgccccgtgggc tgtgccaagtgtgcccagggctgcgtctgcaaaggggcatcggacaagtgcagctgctgc gcctga

DBGET integrated database retrieval system