Equus caballus (horse): 102148270 Help Entry 102148270         CDS       T01058                                  Symbol PPP3R2 Name (RefSeq) calcineurin subunit B type 2   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism ecb  Equus caballus (horse) Pathway ecb04010   MAPK signaling pathway ecb04020   Calcium signaling pathway ecb04022   cGMP-PKG signaling pathway ecb04114   Oocyte meiosis ecb04218   Cellular senescence ecb04310   Wnt signaling pathway ecb04360   Axon guidance ecb04370   VEGF signaling pathway ecb04380   Osteoclast differentiation ecb04625   C-type lectin receptor signaling pathway ecb04650   Natural killer cell mediated cytotoxicity ecb04658   Th1 and Th2 cell differentiation ecb04659   Th17 cell differentiation ecb04660   T cell receptor signaling pathway ecb04662   B cell receptor signaling pathway ecb04720   Long-term potentiation ecb04724   Glutamatergic synapse ecb04921   Oxytocin signaling pathway ecb04922   Glucagon signaling pathway ecb04924   Renin secretion ecb05010   Alzheimer disease ecb05014   Amyotrophic lateral sclerosis ecb05020   Prion disease ecb05022   Pathways of neurodegeneration - multiple diseases ecb05031   Amphetamine addiction ecb05152   Tuberculosis ecb05163   Human cytomegalovirus infection ecb05166   Human T-cell leukemia virus 1 infection ecb05167   Kaposi sarcoma-associated herpesvirus infection ecb05170   Human immunodeficiency virus 1 infection ecb05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ecb05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ecb00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102148270 (PPP3R2)    04310 Wnt signaling pathway     102148270 (PPP3R2)    04370 VEGF signaling pathway     102148270 (PPP3R2)    04020 Calcium signaling pathway     102148270 (PPP3R2)    04022 cGMP-PKG signaling pathway     102148270 (PPP3R2)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     102148270 (PPP3R2)    04218 Cellular senescence     102148270 (PPP3R2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     102148270 (PPP3R2)    04650 Natural killer cell mediated cytotoxicity     102148270 (PPP3R2)    04660 T cell receptor signaling pathway     102148270 (PPP3R2)    04658 Th1 and Th2 cell differentiation     102148270 (PPP3R2)    04659 Th17 cell differentiation     102148270 (PPP3R2)    04662 B cell receptor signaling pathway     102148270 (PPP3R2)   09152 Endocrine system    04922 Glucagon signaling pathway     102148270 (PPP3R2)    04921 Oxytocin signaling pathway     102148270 (PPP3R2)    04924 Renin secretion     102148270 (PPP3R2)   09156 Nervous system    04724 Glutamatergic synapse     102148270 (PPP3R2)    04720 Long-term potentiation     102148270 (PPP3R2)   09158 Development and regeneration    04360 Axon guidance     102148270 (PPP3R2)    04380 Osteoclast differentiation     102148270 (PPP3R2)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102148270 (PPP3R2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102148270 (PPP3R2)    05170 Human immunodeficiency virus 1 infection     102148270 (PPP3R2)    05163 Human cytomegalovirus infection     102148270 (PPP3R2)    05167 Kaposi sarcoma-associated herpesvirus infection     102148270 (PPP3R2)   09171 Infectious disease: bacterial    05152 Tuberculosis     102148270 (PPP3R2)   09164 Neurodegenerative disease    05010 Alzheimer disease     102148270 (PPP3R2)    05014 Amyotrophic lateral sclerosis     102148270 (PPP3R2)    05020 Prion disease     102148270 (PPP3R2)    05022 Pathways of neurodegeneration - multiple diseases     102148270 (PPP3R2)   09165 Substance dependence    05031 Amphetamine addiction     102148270 (PPP3R2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102148270 (PPP3R2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ecb01009]     102148270 (PPP3R2) Protein phosphatases and associated proteins [BR:ecb01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      102148270 (PPP3R2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 EH SPARC_Ca_bdg EF-hand_9 Pam3_gp18 YtfJ_HI0045 RST Motif Other DBs NCBI-GeneID:  102148270 NCBI-ProteinID:  XP_005605726 LinkDB All DBs Position 25:complement(7972495..7973499) Genome browser AA seq 171 aa AA seqDB search MGNEASYPEEMCSQFDHDEIKRLSKRFKKLDLDNSGSLSVDEFLSLPQLQRNPLAKRVID VFDTDGNGVVDFKEFIVGTSQFSVKGSEEQKLRFAFSIYDMDKDGYISNGELFQVLKLMV GDDTLTDWELQEVVDKTIICLDTDGDGKISYEEFSAVVRGLEIHKNLVVAV NT seq 516 nt NT seq  +upstreamnt  +downstreamnt atggggaatgaggccagttacccggaggaaatgtgctcccagtttgaccatgatgaaatt aaaaggctgagcaagaggtttaagaagctggacttggacaattcgggctctctgagcgtg gatgagttcctgtcgctgccccagctgcagcggaatccgttggcgaagagagtgattgac gtcttcgacaccgacggcaatggcgtagtggacttcaaggaattcatcgtggggacctcc cagttcagtgtcaagggcagcgaggagcagaagctaaggtttgctttcagcatctacgac atggacaaagacggctacatttccaacggagagctcttccaggtgctgaagttgatggtg ggggacgacaccctgacagactgggagttacaggaggtcgtcgacaaaaccatcatctgc ctggatacagacggcgatgggaaaatatcctacgaggaattcagcgctgtggtccgaggc ctggagatccacaagaacttggtggtggctgtgtga

DBGET integrated database retrieval system