Equus caballus (horse): 106782966 Help Entry 106782966         CDS       T01058                                  Name (RefSeq) metallothionein-2-like   KO K14739   metallothionein 1/2 Organism ecb  Equus caballus (horse) Pathway ecb04978   Mineral absorption Brite KEGG Orthology (KO) [BR:ecb00001]  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     106782966  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:ecb03019]     106782966    03029 Mitochondrial biogenesis [BR:ecb03029]     106782966 Messenger RNA biogenesis [BR:ecb03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      106782966 Mitochondrial biogenesis [BR:ecb03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     106782966 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  106782966 NCBI-ProteinID:  XP_014593932 LinkDB All DBs Position 3:9726773..9730276 Genome browser AA seq 75 aa AA seqDB search MCGPLSVSTASASWLPAWLSFLAGGSCTCASSCKCKECRCTSCKKSCCPCCPVGCARCAQ GCICKGASDKCSCCA NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgtgtggacccctgtctgtgtctactgcatcagcctcctggctccctgcctggctttcc ttcctggcaggtggctcctgcacctgcgccagctcctgcaaatgcaaagagtgcagatgc acttcctgcaagaagagctgctgcccctgctgccccgtgggctgtgccaggtgtgcccag ggctgcatctgcaaaggggcatcggacaagtgcagctgctgtgcctga

DBGET integrated database retrieval system