Equus caballus (horse): 111769907 Help Entry 111769907         CDS       T01058                                  Symbol GHRH Name (RefSeq) somatoliberin   KO K05260   growth hormone-releasing hormone Organism ecb  Equus caballus (horse) Pathway ecb04080   Neuroactive ligand-receptor interaction ecb04935   Growth hormone synthesis, secretion and action Brite KEGG Orthology (KO) [BR:ecb00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     111769907 (GHRH)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     111769907 (GHRH)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ecb04052]     111769907 (GHRH) Cytokines and neuropeptides [BR:ecb04052]  Neuropeptides   Neuropeptides (GPCR binding)    111769907 (GHRH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hormone_2 Spt5_N Motif Other DBs NCBI-GeneID:  111769907 NCBI-ProteinID:  XP_023481707 LinkDB All DBs Position 22:complement(28529919..28531974) Genome browser AA seq 106 aa AA seqDB search MRLWALFLAILIFSGGCHCSPPSLPLRMPRYADAIFTNNYRKVLGQLSARKILQDIMSRQ HGERNQEQGAKTRFGRQMDSMSAEQEPMALEKVLMALRQKHGNSQG NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atgcggctctgggcgctcttcctcgcgatcctcatcttcagtggtggctgccactgctcc ccaccctccctgcccctcaggatgcctcggtatgcagacgccatcttcaccaacaactac cggaaggtgctgggccagctctctgcccgcaagatcctccaggacatcatgagcagacag cacggagagagaaaccaggagcagggagcgaagactcggtttggccgtcagatggacagc atgtcggcggaacaagagccaatggcattggagaaggtcctgatggccctgcggcagaag cacgggaattcccaaggatga

DBGET integrated database retrieval system