Escherichia coli O6 K2 H1 CFT073 (UPEC): c0101 Help Entry c0101             CDS       T00106                                  Symbol ftsL Name (GenBank) Cell division protein ftsL   KO K03586   cell division protein FtsL Organism ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC) Brite KEGG Orthology (KO) [BR:ecc00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ecc03036]     c0101 (ftsL) Chromosome and associated proteins [BR:ecc03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     c0101 (ftsL) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL DivIC Motif Other DBs NCBI-ProteinID:  AAN78599 UniProt:  P0AEN5 LinkDB All DBs Position 94859..95224 Genome browser AA seq 121 aa AA seqDB search MISRVTEALSKVKGSMGSHERHALPGVIGDDLLRFGKLPLCLFICIILTAVTVVTTAHHT RLLTAQREQLVLERDALDIEWRNLILEENALGDHSRVERIATEKLQMQHVDPSQENIVVQ K NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atgatcagcagagtgacagaagctctaagcaaagttaaaggatcgatgggaagccacgag cgccatgccttgcctggcgttatcggtgacgatcttttgcgatttgggaagctgccactc tgcctgttcatttgcattattttgacggcggtgaccgtggtaaccacggcgcaccatacc cgtttactgaccgctcagcgcgaacaactggtgctggagcgagatgctttagacattgaa tggcgcaacctgatccttgaagagaatgcgctcggcgaccatagccgggtggaaagaata gccacggaaaagctgcaaatgcagcatgttgatccgtcacaagaaaatatcgtagtgcaa aaataa

DBGET integrated database retrieval system