Escherichia coli O6 K2 H1 CFT073 (UPEC): c1364 Help Entry c1364             CDS       T00106                                  Symbol acpP Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC) Pathway ecc01100   Metabolic pathways ecc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ecc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     c1364 (acpP)    00074 Mycolic acid biosynthesis     c1364 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     c1364 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB HLH Motif Other DBs NCBI-ProteinID:  AAN79834 UniProt:  P0A6A9 LinkDB All DBs Position 1295117..1295353 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgaacagctgggcgttaagcag gaagaagttaccaacaatgcttctttcgttgaagacctgggcgcggattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgccattgattacatcaacggccaccaggcgtaa

DBGET integrated database retrieval system