Escherichia coli O6 K2 H1 CFT073 (UPEC): c3144 Help Entry c3144             CDS       T00106                                  Name (GenBank) DNA-damage-inducible protein I   KO K12149   DNA-damage-inducible protein I Organism ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC) Brite KEGG Orthology (KO) [BR:ecc00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:ecc03400]     c3144 DNA repair and recombination proteins [BR:ecc03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     c3144 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI MAPKK1_Int Motif Other DBs NCBI-ProteinID:  AAN81594 UniProt:  A0A0H2V9V4 LinkDB All DBs Position 3019963..3020169 Genome browser AA seq 68 aa AA seqDB search MPNGAVDALKEELTRRISKRYDDVEVIVKATSNDGLSVTRTADKDSAKTFVQETLKDTWE SADEWFVH NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgccaaacggtgctgtggatgcgttaaaggaagaattaactcgacgcatcagtaagcgt tatgacgatgtagaggtgatcgtaaaagccaccagcaacgatggcctttctgttacgcgc accgccgataaagattcagctaaaacttttgttcaggaaactctgaaagatacctgggag tctgctgacgagtggtttgttcactaa

DBGET integrated database retrieval system