Escherichia coli K-12 DH10B: ECDH10B_0378 Help Entry ECDH10B_0378      CDS       T00666                                  Symbol xseB Name (GenBank) exonuclease VII small subunit   KO K03602   exodeoxyribonuclease VII small subunit [EC:3.1.11.6] Organism ecd  Escherichia coli K-12 DH10B Pathway ecd03430   Mismatch repair Brite KEGG Orthology (KO) [BR:ecd00001]  09120 Genetic Information Processing   09124 Replication and repair    03430 Mismatch repair     ECDH10B_0378 (xseB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:ecd03400]     ECDH10B_0378 (xseB) Enzymes [BR:ecd01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters     3.1.11.6  exodeoxyribonuclease VII      ECDH10B_0378 (xseB) DNA repair and recombination proteins [BR:ecd03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA exonucleases      ECDH10B_0378 (xseB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Exonuc_VII_S KxDL DUF6687 Motif Other DBs NCBI-ProteinID:  ACB01550 UniProt:  B1XF10 LinkDB All DBs Position complement(379656..379898) Genome browser AA seq 80 aa AA seqDB search MPKKNEAPASFEKALSELEQIVTRLESGDLPLEEALNEFERGVQLARQGQAKLQQAEQRV QILLSDNEDASLTPFTPDNE NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgccgaagaaaaatgaggcgcccgccagctttgaaaaggcgctgagcgagctggaacag attgtaacccgtctggaaagtggcgacctgccgctggaagaggcgctgaacgagttcgaa cgcggcgtgcagctggcacgtcaggggcaggccaaattacaacaagccgaacagcgcgta caaattctgctgtctgacaatgaagacgcctctctaaccccttttacaccggacaatgag taa

DBGET integrated database retrieval system