Escherichia coli O157 H7 EDL933 (EHEC): Z1547 Help Entry Z1547             CDS       T00044                                  Name (GenBank) putative acyl-carrier protein   KO K02078   acyl carrier protein Organism ece  Escherichia coli O157:H7 EDL933 (EHEC) Pathway ece01100   Metabolic pathways ece01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ece00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Z1547    00074 Mycolic acid biosynthesis     Z1547   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Z1547 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AAG55662 UniProt:  A0A9Q6ZPI9 LinkDB All DBs Position 1440959..1441240 Genome browser AA seq 93 aa AA seqDB search MSTMNDAIEQRKEVLMTIKTEIIQRLNIQRDEAQIDDDTALFGNGFKLDSVDATEIVVLL DKVFDIKISESDDPSYMRSINSLATFVIQKKND NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgtctaccatgaatgacgctattgaacagcgtaaagaagttctgatgaccattaaaact gagatcatccagcgactgaatattcaacgcgatgaagcgcaaattgatgatgatactgcg ctgtttggtaatggttttaaactggactccgtcgatgcaacggaaattgtcgttctgctg gataaagtatttgatatcaagatcagcgaaagtgacgacccgtcctatatgcgcagtatc aatagtctggccaccttcgttattcaaaagaaaaacgattaa

DBGET integrated database retrieval system