Escherichia coli O157 H7 EDL933 (EHEC): Z1733 Help Entry Z1733             CDS       T00044                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ece  Escherichia coli O157:H7 EDL933 (EHEC) Pathway ece01100   Metabolic pathways ece01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ece00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Z1733 (acpP)    00074 Mycolic acid biosynthesis     Z1733 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Z1733 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB HLH Motif Other DBs NCBI-ProteinID:  AAG55840 UniProt:  P0A6B0 LinkDB All DBs Position 1595796..1596032 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgaacagctgggcgttaagcag gaagaagttaccaacaatgcttctttcgttgaagacctaggcgcggattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgccattgattacatcaacggccaccaggcgtaa

DBGET integrated database retrieval system