Escherichia coli O157 H7 EDL933 (EHEC): Z3916 Help Entry Z3916             CDS       T00044                                  Name (GenBank) hypothetical protein   KO K12149   DNA-damage-inducible protein I Organism ece  Escherichia coli O157:H7 EDL933 (EHEC) Brite KEGG Orthology (KO) [BR:ece00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:ece03400]     Z3916 DNA repair and recombination proteins [BR:ece03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     Z3916 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI MAPKK1_Int MinE Motif Other DBs NCBI-ProteinID:  AAG57731 UniProt:  P58218 LinkDB All DBs Position 3546082..3546330 Genome browser AA seq 82 aa AA seqDB search MRIEICIAKEKMTKMPNGAVDALKEELTRRISKRYDDVEVIVKATSNDGLSVTRTADKDS AKTFVQETLKDTWKSADEWFVH NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgcgtattgagatctgcatagccaaagaaaaaatgactaaaatgccaaacggtgctgtg gatgcgttaaaggaagaattaacccgacgcatcagtaaacgttatgacgatgtagaggtg atcgtaaaagccaccagcaacgatggcctttctgttacgcgcaccgccgataaagattca gctaaaacttttgttcaggagactctgaaagatacctggaagtctgctgacgagtggttt gttcactaa

DBGET integrated database retrieval system