KEGG   Escherichia coli O157 H7 EDL933 (EHEC): Z3918
Entry
Z3918             CDS       T00044                                 
Name
(GenBank) putative chaperone protein
  KO
K23653  T3SS effector EspM
Organism
ece  Escherichia coli O157:H7 EDL933 (EHEC)
Pathway
ece05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:ece00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    Z3918
SSDB
Motif
Pfam: IpaB_EvcA Potyvirid-P3
Other DBs
NCBI-ProteinID: AAG57733
UniProt: A0A4P8B720
LinkDB
Position
complement(3546832..3547422)
AA seq 196 aa
MPMNTTGMSFSSFGISCHRENSFRNSFRGKNDEVVKCSIGERTISFSVRKFSGNILETVR
RQSTKDIDEWIKDERIVYPSRVINQEIDNYCFQKNAKISTEERQRVFFLVSQENQLTLDV
KAAQSSINHVIMGSASFGKKMDALCDGMSRDVKNRTSDTIANLLADKFYQKHIDSDIDIV
KLRNDIPDYLMRAIQG
NT seq 591 nt   +upstreamnt  +downstreamnt
atgccgatgaatactacaggtatgtctttcagctcttttggtataagttgccatagagag
aactccttcaggaactctttccgagggaagaatgatgaggtcgtaaaatgttcaattgga
gaacggactattagcttttctgttcgcaaatttagcggcaatatactggaaacggtgaga
aggcagagtactaaagatattgatgagtggataaaagatgaacggatagtatatccctca
agggtgatcaaccaggagattgataattactgttttcaaaaaaatgcaaaaatttccact
gaagagaggcaaagagtcttttttcttgtgagccaggagaatcaactaacccttgatgtt
aaggcagcacaaagttctattaatcatgtaataatggggagtgcttcttttggcaagaaa
atggatgctctttgtgatggtatgagccgggatgtaaaaaatcgtacatcagataccata
gcaaacttgcttgcggacaagttttaccagaaacatatcgattcggatattgatattgta
aaactacgaaatgatatcccagattatttgatgcgtgctatacagggatga

DBGET integrated database retrieval system