Escherichia coli O157 H7 EDL933 (EHEC): Z4853 Help Entry Z4853             CDS       T00044                                  Name (GenBank) putative acyl carrier protein   KO K02078   acyl carrier protein Organism ece  Escherichia coli O157:H7 EDL933 (EHEC) Pathway ece01100   Metabolic pathways ece01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ece00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Z4853    00074 Mycolic acid biosynthesis     Z4853   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Z4853 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AAG58588 UniProt:  A0A9Q6ZJ57 LinkDB All DBs Position 4402837..4403094 Genome browser AA seq 85 aa AA seqDB search MQALYLEIKNLIISTLNLDELTPDDIDTDAPLFGDGLGLDSIDALELGLAVKNEYGIVLS AESEEMRQHFFSVATLASFIAAQRA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcaagcgctttatctggaaattaaaaacctcatcatcagcaccctcaatctggacgag ttgacgcctgatgatatcgataccgacgcgccgctgtttggcgacggtttagggctggac tctatcgatgccctggaactgggactggcagtaaaaaatgagtacggcatcgtgctctct gcggaaagcgaagagatgcgtcagcactttttctccgtcgccactctggcctctttcatt gctgcgcaacgtgcctga

DBGET integrated database retrieval system