KEGG   Escherichia coli O157 H7 EC4115 (EHEC): ECH74115_1815
Entry
ECH74115_1815     CDS       T00778                                 
Name
(GenBank) EspM3 protein
  KO
K23653  T3SS effector EspM
Organism
ecf  Escherichia coli O157:H7 EC4115 (EHEC)
Pathway
ecf05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:ecf00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    ECH74115_1815
SSDB
Motif
Pfam: IpaB_EvcA Potyvirid-P3
Other DBs
NCBI-ProteinID: ACI37052
LinkDB
Position
1733268..1733858
AA seq 196 aa
MPVNATGVSFSSFGISYHKDNSFRGTIRGKNDEVVKCSMGERSIRFNVNKFSGCILETVS
RQSTKDIHGWVSDERTVYPSRVINQEIDNCCLQKNAKISSEERKMVFSLVSKEFELTLDV
KAAQSSINHIIIGNASFGKKMDALCDGMSRAVKNSTTDYIANVLADKFYQKHIAPGVDIV
KLRNEIPGYMSRVIQG
NT seq 591 nt   +upstreamnt  +downstreamnt
atgccagtaaatgcgacaggtgtgtccttcagctcttttggtatcagttatcataaagat
aattctttccggggcaccatccgtgggaagaatgatgaggtcgtgaagtgttcaatggga
gagcgctctatccgctttaatgttaacaaatttagcggctgtatactggagacggtaagc
aggcagagtactaaagatattcatggatgggtaagtgatgaacggacagtatatccgtca
agggttatcaaccaagagattgataattgctgccttcaaaaaaatgcaaaaatttcttct
gaagagaggaaaatggtcttttctcttgtaagtaaggagtttgaactaactcttgatgtt
aaagcggcacaaagttctattaatcatataataataggaaatgcttcttttggcaaaaaa
atggatgctctttgcgatggtatgagccgagctgtaaaaaacagtacaacagattacata
gcaaacgtgcttgcagacaagttttatcagaaacatatcgccccgggtgttgatattgta
aaactacgaaatgaaatcccaggttatatgagtcgtgttatacaggggtaa

DBGET integrated database retrieval system