Escherichia coli O157 H7 EC4115 (EHEC): ECH74115_2221 Help Entry ECH74115_2221     CDS       T00778                                  Name (GenBank) conserved domain protein   KO K12149   DNA-damage-inducible protein I Organism ecf  Escherichia coli O157:H7 EC4115 (EHEC) Brite KEGG Orthology (KO) [BR:ecf00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:ecf03400]     ECH74115_2221 DNA repair and recombination proteins [BR:ecf03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     ECH74115_2221 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI Tom37 MAPKK1_Int DUF7320 Motif Other DBs NCBI-ProteinID:  ACI37394 LinkDB All DBs Position 2112165..2112371 Genome browser AA seq 68 aa AA seqDB search MPKGSVPALQQEMLRRVSKRYDDVEVIIKSTSNDGLSVTRTADKDSAKTFVQETLKDTWE SADEWFVR NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgccaaaaggttctgttcctgccctgcaacaagaaatgctgcgacgtgtcagtaaacgt tatgacgatgtagaagtgatcatcaaatccaccagcaacgatggcctttcagttactcgc accgccgataaagattctgcaaaaacttttgttcaggagacgctgaaagatacctgggag tctgctgacgagtggtttgttcgctaa

DBGET integrated database retrieval system