Escherichia coli O157 H7 EC4115 (EHEC): ECH74115_5913
Help
Entry
ECH74115_5913 CDS
T00778
Symbol
creB
Name
(GenBank) transcriptional regulatory protein CreB
KO
K07663
two-component system, OmpR family, catabolic regulation response regulator CreB
Organism
ecf
Escherichia coli O157:H7 EC4115 (EHEC)
Pathway
ecf02020
Two-component system
Brite
KEGG Orthology (KO) [BR:
ecf00001
]
09130 Environmental Information Processing
09132 Signal transduction
02020 Two-component system
ECH74115_5913 (creB)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02022 Two-component system [BR:
ecf02022
]
ECH74115_5913 (creB)
Two-component system [BR:
ecf02022
]
OmpR family
CreC-CreB (phosphate regulation)
ECH74115_5913 (creB)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Response_reg
Trans_reg_C
HTH_11
GlnR_1st
DUF7669
Motif
Other DBs
NCBI-ProteinID:
ACI38828
LinkDB
All DBs
Position
5566430..5567119
Genome browser
AA seq
229 aa
AA seq
DB search
MQRETVWLVEDEQGIADTLVYMLQQEGFAVEVFERGLPVLDKARQQVPDVMILDVGLPDI
SGFELCRQLLALHPALPVLFLTARSEEVDRLLGLEIGADDYVAKPFSPREVCARVRTLLR
RVKKFSTPSPVIRIGHFELNEPAAQISWFDTPLTLTRYEFLLLKTLLKSPGRVWSRQQLM
DIVWEDAQDTYDRTVDTHIKTLRAKLRAINPDLSPINTHRGMGYSLRSL
NT seq
690 nt
NT seq
+upstream
nt +downstream
nt
atgcaacgggaaacggtctggttagtggaagatgagcaagggatagccgacacgctggtc
tacatgttgcagcaggaaggttttgccgtcgaggtctttgagcgaggcttgccggtgctg
gataaagctcgccagcaggttcccgatgtcatgattctcgacgttggtttgcctgatatc
agtggctttgaattgtgccgccagttactggcgctccatccggcgttacctgtactgttc
ctgacggcccgaagtgaagaggtcgatcgcctgcttgggctggaaattggcgctgacgac
tatgtggctaaaccgttttcaccccgcgaagtgtgcgctagggtgcgcaccttgctgcgt
cgggtgaagaagttctcgacgccgtctcccgtcatccgtattggtcattttgaattgaat
gaacccgcggcgcagatcagctggtttgacacgccattaacgctgacgcggtatgagttt
ttattgctgaagacgttactcaagtcgccaggccgcgtctggtcccgccagcaactgatg
gatatcgtgtgggaagatgcgcaggacacctacgatcgcaccgtcgatacccacattaaa
acgctgcgtgccaagctgcgcgccatcaaccccgatctttcaccgattaatactcatcgc
ggcatgggatacagcctgaggagcctgtaa
DBGET
integrated database retrieval system