KEGG   Escherichia coli O127 H6 E2348/69 (EPEC): E2348C_1445
Entry
E2348C_1445       CDS       T00796                                 

Definition
(GenBank) T3SS secreted effector NleF homolog
  KO
K23658  T3SS secreted effector NleF
Organism
ecg  Escherichia coli O127:H6 E2348/69 (EPEC)
Pathway
ecg05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:ecg00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    E2348C_1445
SSDB
Motif
Pfam: NleF_casp_inhib DUF4468
Other DBs
NCBI-ProteinID: CAS08993
UniProt: B7UR63
LinkDB
Structure
PDB: 
3V3K

Position
1477701..1478270
AA seq 189 aa
MLPTSGSSANLYSWMYVSGRGNPSTPESVSELNHNHFLSPELQDKLDVMVSIYSCARNNN
ELEEIFQELSAFVSGLMDKRNSVFEVRNENTDEVVGALRAGMTIEDRDSYIRDLFFLHSL
KVKIEESRQGKEDSKCKVYNLLCPHHSSELYGDLRAMKCLVEGCSDDFNPFDIIRVPDLT
YNKGSLQCG
NT seq 570 nt   +upstreamnt  +downstreamnt
atgttaccaacaagtggttcttcagcaaatctttattcatggatgtatgtatcaggaaga
ggtaacccttcgactccggaatcagtaagtgagcttaatcataatcactttctttctcct
gaattacaagataaacttgatgttatggtctctatatattcatgtgccagaaataataat
gagcttgaggaaatttttcaagagctaagtgcttttgtaagtgggctgatggataagaga
aatagtgtatttgaggtgagaaatgaaaatactgatgaggttgtcggagcgctgagggcg
ggaatgacgatagaggatagggatagttatatcagggatcttttttttctgcattcattg
aaagtaaaaattgaggaaagtagacaaggcaaagaagattcgaaatgtaaagtttataat
ctgctatgtccgcatcactcttcagagctatatggtgatctacgagcaatgaaatgcctc
gtggaaggatgcagtgatgattttaatccttttgatattattagggtaccagatcttact
tacaacaaaggatctttacaatgtggatga

DBGET integrated database retrieval system