KEGG   Escherichia coli O127 H6 E2348/69 (EPEC): E2348C_3942
Entry
E2348C_3942       CDS       T00796                                 
Symbol
map
Name
(GenBank) LEE-encoded effector Map
  KO
K12787  LEE-encoded effector Map
Organism
ecg  Escherichia coli O127:H6 E2348/69 (EPEC)
Pathway
ecg05130  Pathogenic Escherichia coli infection
Module
ecg_M00542  EHEC/EPEC pathogenicity signature, T3SS and effectors
Brite
KEGG Orthology (KO) [BR:ecg00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    E2348C_3942 (map)
SSDB
Motif
Pfam: IpaB_EvcA Hydrolase_6
Other DBs
NCBI-ProteinID: CAS11490
UniProt: B7UMA0
LinkDB
Position
complement(4115809..4116420)
AA seq 203 aa
MFSPTAMVGRALAQAVTQTLRPAVTKAATQAGMAASGMRFTPMQSNLMINHGKLTTQLLQ
AVAKQTGSSDTQQWFKQEQITFLSRAVNKTVDDYCMSNNSAISKETKCRIFKEVESAIQQ
PLDMNCAQSSISHFLQSNKYFNQKVDEQCGKGVDPITRFNTQTKLIEQVSREIFEQNFST
AKISDIKALTEKAIADNVQDTRL
NT seq 612 nt   +upstreamnt  +downstreamnt
atgtttagtccaacggcaatggtaggtagagcgttagctcaggcggttacacaaactctt
agacccgctgtaaccaaggctgcgacgcaagcgggcatggcagccagtggtatgaggttc
acacctatgcagtcgaaccttatgattaatcatggcaaactgactacccagctactacag
gccgtagccaaacaaactggtagtagtgatacccagcaatggttcaagcaagagcagatt
acttttctatccagagcagtaaacaaaactgtggatgactattgcatgagtaataattcg
gcaattagtaaggagactaaatgtcgcatttttaaagaggttgaaagcgcgatacaacag
cctctcgatatgaactgtgcacaatcatcaattagtcactttttgcaatccaataaatac
tttaatcagaaagttgatgagcagtgtggtaaaggagtggatcccattacacgttttaac
actcaaaccaaattgatagaacaagtctcacgcgaaatctttgaacagaattttagcacc
gcgaaaatcagtgatatcaaggctctaactgagaaggcgattgcagacaatgtgcaggat
actcggctgtag

DBGET integrated database retrieval system